(data stored in ACNUC30630 zone)

EMBL: BX251410.PE174

BX251410.PE174       Location/Qualifiers
FT   CDS             228065..228706
FT                   /transl_table=11
FT                   /locus_tag="TW189"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Possible
FT                   coiled-coil region at residues 42-80."
FT                   /protein_id="CAD66866.1"
FT                   /translation="MRRKLLPVLLFSVFLWVCLPAQSAQAFLFDGKNNIFKQLQQTAEK
FT                   KLKELKGTAQKAVNTVKKKVEQAKHTAETKVKELQNTVATAVHNAVQPKPQKRPAKPVA
FT                   TKAPPAPKPSSSSAPSRVSPPTPPTHSSSASASVTHSSSIPSATHSSNSSSARESSGAT
FT                   STSSSSADAGKSVAAESSPGLLIPAAITAAVTVAITSITAVMYIVFSRFL"
     MRRKLLPVLL FSVFLWVCLP AQSAQAFLFD GKNNIFKQLQ QTAEKKLKEL KGTAQKAVNT        60
     VKKKVEQAKH TAETKVKELQ NTVATAVHNA VQPKPQKRPA KPVATKAPPA PKPSSSSAPS       120
     RVSPPTPPTH SSSASASVTH SSSIPSATHS SNSSSARESS GATSTSSSSA DAGKSVAAES       180
     SPGLLIPAAI TAAVTVAITS ITAVMYIVFS RFL                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page