(data stored in ACNUC30630 zone)

EMBL: BX251410.PE176

BX251410.PE176       Location/Qualifiers
FT   CDS             229601..229825
FT                   /transl_table=11
FT                   /locus_tag="TW191"
FT                   /product="putative secreted protein"
FT                   /note="N-terminus similar to that of Caulobacter crescentus
FT                   hypothetical protein Cc2002 SWALL:Q9A6T1 (EMBL:AE005873)
FT                   (200 aa) fasta scores: E(): 5.2, 31.91% id in 47 aa"
FT                   /protein_id="CAD66868.1"
FT                   /translation="MHVLGIGLDKIVIIAFFAALLLSPSQLLAYAKKIGFYAGKIRVMS
FT                   DLVKKQFVDATSERKVPVGDFSVTDDEAT"
     MHVLGIGLDK IVIIAFFAAL LLSPSQLLAY AKKIGFYAGK IRVMSDLVKK QFVDATSERK        60
     VPVGDFSVTD DEAT                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page