(data stored in ACNUC30630 zone)

EMBL: BX251410.PE177

BX251410.PE177       Location/Qualifiers
FT   CDS             229953..230495
FT                   /transl_table=11
FT                   /locus_tag="TW192"
FT                   /product="possible integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66869.1"
FT                   /translation="MPKTNIKFLIITLSVIFSLIFIATPTYATTSVTTDKAVATTTEPK
FT                   ANQIIKELEQAGFTKQVTGNKRQETITLTKDGVTVTLTHVTQQTQTRLSWGDDPWGFYI
FT                   KLEWHEQVALAAGTLAAGGGAGLALKAALKIAVKAGTAFLAGLEVVDKLSDIIGAGPCP
FT                   PFQPRYIRFDPFRTKCG"
     MPKTNIKFLI ITLSVIFSLI FIATPTYATT SVTTDKAVAT TTEPKANQII KELEQAGFTK        60
     QVTGNKRQET ITLTKDGVTV TLTHVTQQTQ TRLSWGDDPW GFYIKLEWHE QVALAAGTLA       120
     AGGGAGLALK AALKIAVKAG TAFLAGLEVV DKLSDIIGAG PCPPFQPRYI RFDPFRTKCG       180
//

If you have problems or comments...

PBIL Back to PBIL home page