(data stored in ACNUC30630 zone)

EMBL: BX251410.PE178

BX251410.PE178       Location/Qualifiers
FT   CDS             230519..231298
FT                   /transl_table=11
FT                   /locus_tag="TW193"
FT                   /product="possible integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66870.1"
FT                   /translation="MPKTTTSVTQPRQSSFFPLLTGFFTYLFLLTRPHKRRLFMAGLVR
FT                   KYYRDSTARTVLSTTDIFLFSFVITFAIAVLIGMSSALYFIIASVPGAVVYESSLWQFV
FT                   WWSSILVSFVVAYLYLQIFSPSDRSFLLRYSYYSQTPSFQNPTKRRQILLLDTVTRYGS
FT                   KYYRDLAKFWLTLLAILVFIGALFIFVTQNFSILNPIFLLLFLLSCLISFLVIDSLSGS
FT                   LVRKLLYNLHIRRHGPIPKELTDIVTQAYEIYPQVTT"
     MPKTTTSVTQ PRQSSFFPLL TGFFTYLFLL TRPHKRRLFM AGLVRKYYRD STARTVLSTT        60
     DIFLFSFVIT FAIAVLIGMS SALYFIIASV PGAVVYESSL WQFVWWSSIL VSFVVAYLYL       120
     QIFSPSDRSF LLRYSYYSQT PSFQNPTKRR QILLLDTVTR YGSKYYRDLA KFWLTLLAIL       180
     VFIGALFIFV TQNFSILNPI FLLLFLLSCL ISFLVIDSLS GSLVRKLLYN LHIRRHGPIP       240
     KELTDIVTQA YEIYPQVTT                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page