(data stored in ACNUC30630 zone)

EMBL: BX251410.PE182

BX251410.PE182       Location/Qualifiers
FT   CDS             complement(235965..236714)
FT                   /transl_table=11
FT                   /locus_tag="TW197"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO3849 or SCH69.19c SWALL:Q9XA15
FT                   (EMBL:AL079308) (253 aa) fasta scores: E(): 9.6e-09, 25.6%
FT                   id in 250 aa"
FT                   /protein_id="CAD66874.1"
FT                   /translation="MIAKHTKRGVKFPRGEQAKPASGWSRIVMIFGELSMTAGVLVGIF
FT                   YTWVLYIDSPLTAWEQGNSANLTASQFMRHRSDATETMPVTDRVKDYEDIAVLFVPRFG
FT                   NKYKRVIRETTDVTRVLNSKTAGVGHYPHTALPGTSGNFAVAAHEVGWGAAFGKLSELR
FT                   LGDKIYVLTPKGWYIYAYRSSEYVKPDGVNVLRPLPQSFAVPDETYIMTMTTCNPPFSV
FT                   AERLIAYAVLEKWQADVPHEIVNIVNS"
     MIAKHTKRGV KFPRGEQAKP ASGWSRIVMI FGELSMTAGV LVGIFYTWVL YIDSPLTAWE        60
     QGNSANLTAS QFMRHRSDAT ETMPVTDRVK DYEDIAVLFV PRFGNKYKRV IRETTDVTRV       120
     LNSKTAGVGH YPHTALPGTS GNFAVAAHEV GWGAAFGKLS ELRLGDKIYV LTPKGWYIYA       180
     YRSSEYVKPD GVNVLRPLPQ SFAVPDETYI MTMTTCNPPF SVAERLIAYA VLEKWQADVP       240
     HEIVNIVNS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page