(data stored in ACNUC30630 zone)

EMBL: BX251410.PE187

BX251410.PE187       Location/Qualifiers
FT   CDS             240175..241269
FT                   /transl_table=11
FT                   /locus_tag="TW202"
FT                   /product="putative ABC transporter branched chain amino
FT                   acid transport permease"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport system permease protein
FT                   LivM or b3456 SWALL:LIVM_ECOLI (SWALL:P22729) (425 aa)
FT                   fasta scores: E(): 2.9e-14, 36.19% id in 326 aa"
FT                   /protein_id="CAD66879.1"
FT                   /translation="MMGFLSSVMRWWKGMSRPQQWFFLLPFVVLVYLLPIINPPVITTE
FT                   PGNNFPISLFTMAIYALAAVGLNVVVGYAGLLDLGYIAFFAVGAYVSAVFTSPDSPYVK
FT                   IPYLWTIPVAIFTAMVFGAALGVPTLRLRGDYLAIVTLGFGEIVRIMATVIPALRGNLG
FT                   FSNVGHPPGDYPSGQPIFTPDNGVAWYWVAITVVIFVLVIVGNLERSIVGRNWFAICQD
FT                   EDAAEVMGVNTFSFKVWAFAIGAAIGGLSGSLQAAQTGFVNNQRFDVATSVLFLVAVVL
FT                   GGSGNKFGAAIGGALVAYIPLRFTEIAQYKYLIFGVCLILLMLFRHEGLFPMKANLFSR
FT                   QVLLRKLSLRHSPDKRASSSPSGS"
     MMGFLSSVMR WWKGMSRPQQ WFFLLPFVVL VYLLPIINPP VITTEPGNNF PISLFTMAIY        60
     ALAAVGLNVV VGYAGLLDLG YIAFFAVGAY VSAVFTSPDS PYVKIPYLWT IPVAIFTAMV       120
     FGAALGVPTL RLRGDYLAIV TLGFGEIVRI MATVIPALRG NLGFSNVGHP PGDYPSGQPI       180
     FTPDNGVAWY WVAITVVIFV LVIVGNLERS IVGRNWFAIC QDEDAAEVMG VNTFSFKVWA       240
     FAIGAAIGGL SGSLQAAQTG FVNNQRFDVA TSVLFLVAVV LGGSGNKFGA AIGGALVAYI       300
     PLRFTEIAQY KYLIFGVCLI LLMLFRHEGL FPMKANLFSR QVLLRKLSLR HSPDKRASSS       360
     PSGS                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page