(data stored in ACNUC30630 zone)

EMBL: BX251410.PE188

BX251410.PE188       Location/Qualifiers
FT   CDS             241271..242053
FT                   /transl_table=11
FT                   /locus_tag="TW203"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter ATP-binding subunit"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivG or b3455 or z4825 or ecs4302 SWALL:LIVG_ECOLI
FT                   (SWALL:P22730) (255 aa) fasta scores: E(): 4.7e-36, 47.43%
FT                   id in 253 aa"
FT                   /protein_id="CAD66880.1"
FT                   /translation="MQDALLQSEHLLDVRDLVVRFGGIVALDGVSFSVGRGEILALIGP
FT                   NGAGKTTLFNVITGVYRPTSGDVSLESVSLKSVKRYRIARMGIARTFQNIRLFGGMTVL
FT                   ENVAVGLGVHHKTHILGALFRTPRHCREEREIVERGLEILDMVGIAQDAYKLAGSLSYG
FT                   SQRRLEIARALACQPKLLCLDEPAAGFNPAEKNQLVELILKIRDAGYSILLIEHDMKLI
FT                   FDVADRVVVLDFGKKIADGLPDDVRNDPHVIAAYLGEG"
     MQDALLQSEH LLDVRDLVVR FGGIVALDGV SFSVGRGEIL ALIGPNGAGK TTLFNVITGV        60
     YRPTSGDVSL ESVSLKSVKR YRIARMGIAR TFQNIRLFGG MTVLENVAVG LGVHHKTHIL       120
     GALFRTPRHC REEREIVERG LEILDMVGIA QDAYKLAGSL SYGSQRRLEI ARALACQPKL       180
     LCLDEPAAGF NPAEKNQLVE LILKIRDAGY SILLIEHDMK LIFDVADRVV VLDFGKKIAD       240
     GLPDDVRNDP HVIAAYLGEG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page