(data stored in ACNUC30630 zone)

EMBL: BX251410.PE189

BX251410.PE189       Location/Qualifiers
FT   CDS             242078..242761
FT                   /transl_table=11
FT                   /locus_tag="TW204"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter ATP-binding subunit"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivF or b3454 SWALL:LIVF_ECOLI (SWALL:P22731) (237 aa)
FT                   fasta scores: E(): 1.4e-33, 52.42% id in 227 aa"
FT                   /protein_id="CAD66881.1"
FT                   /translation="MNVSYGKIRVLYDISFTVNRGEIVSLIGSNGAGKTTLMRTISGLL
FT                   NTSGKILFQGEDITKYAPYKRVLSGISQSPEGRGVFPGMTVRENLDMGAYARKDRKNIK
FT                   DDFDRVYGLFPRLLERRDQLGGAMSGGEQQMLAIARAIMSRPKLLLLDEPSMGLAPQLI
FT                   QQIFSIVREINRQGVTILMVEQNANQSLGISDHAMVLETGNITRTGTGKELLQDGSIRK
FT                   AYLGV"
     MNVSYGKIRV LYDISFTVNR GEIVSLIGSN GAGKTTLMRT ISGLLNTSGK ILFQGEDITK        60
     YAPYKRVLSG ISQSPEGRGV FPGMTVRENL DMGAYARKDR KNIKDDFDRV YGLFPRLLER       120
     RDQLGGAMSG GEQQMLAIAR AIMSRPKLLL LDEPSMGLAP QLIQQIFSIV REINRQGVTI       180
     LMVEQNANQS LGISDHAMVL ETGNITRTGT GKELLQDGSI RKAYLGV                     227
//

If you have problems or comments...

PBIL Back to PBIL home page