(data stored in ACNUC30630 zone)

EMBL: BX251410.PE19

BX251410.PE19        Location/Qualifiers
FT   CDS             18975..20372
FT                   /transl_table=11
FT                   /locus_tag="TW019"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   dihydrolipoamide dehydrogenase/glutathione oxidoreductase
FT                   and related enzymes cgl0688 SWALL:BAB98081 (EMBL:AP005276)
FT                   (469 aa) fasta scores: E(): 6.5e-76, 48.58% id in 459 aa,
FT                   and to Bacillus subtilis dihydrolipoamide dehydrogenase
FT                   PdhD or AceD or CitL SWALL:DLD1_BACSU (SWALL:P21880) (470
FT                   aa) fasta scores: E(): 1.6e-35, 30.99% id in 442 aa"
FT                   /protein_id="CAD66711.1"
FT                   /translation="MSVKKNHKIVVIGGGPGGYSAALSGALLGADVVLIENQAVGGSAT
FT                   LTDVVPSKTLIASAERAVFVAQGADFGIRFQNCVSADIGHINRRIMDLTRAQSADMFST
FT                   LTGAGVRVVYGHAALDGPNRVLVSVSGQEKYEFFANTVVVATGSSPRVLPNAIPDGKRI
FT                   LTWKQLYTLEQVPEHIIVVGSGVTGAEFASAFRNLGSEVTLVSSRDRVLPGGDEDAADL
FT                   IQEVFINSGMKLLNRARAQAAAACNGGVVVTLTDGTEVRGTHCLMAVGSVPNTSGIGLE
FT                   TANIALNPAGRITVNRVACSSVPGVYAAGDCSDFLPLASVAEMQGQVAVYHAMGENANP
FT                   IELKNLASTVFTTPEIATVGRSEKAIDKARATALKVDLATNSRAKILGIKTGFVKMIVS
FT                   RETGTVLGGVVVAPNASDLIFPISVAVQNRLSADQLSQSFAVYPSLTISLWHAARASHV
FT                   RTDSASP"
     MSVKKNHKIV VIGGGPGGYS AALSGALLGA DVVLIENQAV GGSATLTDVV PSKTLIASAE        60
     RAVFVAQGAD FGIRFQNCVS ADIGHINRRI MDLTRAQSAD MFSTLTGAGV RVVYGHAALD       120
     GPNRVLVSVS GQEKYEFFAN TVVVATGSSP RVLPNAIPDG KRILTWKQLY TLEQVPEHII       180
     VVGSGVTGAE FASAFRNLGS EVTLVSSRDR VLPGGDEDAA DLIQEVFINS GMKLLNRARA       240
     QAAAACNGGV VVTLTDGTEV RGTHCLMAVG SVPNTSGIGL ETANIALNPA GRITVNRVAC       300
     SSVPGVYAAG DCSDFLPLAS VAEMQGQVAV YHAMGENANP IELKNLASTV FTTPEIATVG       360
     RSEKAIDKAR ATALKVDLAT NSRAKILGIK TGFVKMIVSR ETGTVLGGVV VAPNASDLIF       420
     PISVAVQNRL SADQLSQSFA VYPSLTISLW HAARASHVRT DSASP                       465
//

If you have problems or comments...

PBIL Back to PBIL home page