(data stored in ACNUC30630 zone)

EMBL: BX251410.PE21

BX251410.PE21        Location/Qualifiers
FT   CDS             complement(22333..22752)
FT                   /transl_table=11
FT                   /locus_tag="TW021"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66713.1"
FT                   /translation="MVNMTKTEARAANAAFWQYPAHQPQQRPEFTTDSISRAHTTYMYA
FT                   QYRYATHWACTLLRVIHLSREEETAAALAAIMFIESESCRDVNSKAINKTTDCCNERNT
FT                   KNNWNIRVWSTRSWPSGGTLLPRKYEPLICRQWAR"
     MVNMTKTEAR AANAAFWQYP AHQPQQRPEF TTDSISRAHT TYMYAQYRYA THWACTLLRV        60
     IHLSREEETA AALAAIMFIE SESCRDVNSK AINKTTDCCN ERNTKNNWNI RVWSTRSWPS       120
     GGTLLPRKYE PLICRQWAR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page