(data stored in ACNUC30630 zone)

EMBL: BX251410.PE212

BX251410.PE212       Location/Qualifiers
FT   CDS             254911..255774
FT                   /transl_table=11
FT                   /locus_tag="TW227"
FT                   /product="putative aminotransferase"
FT                   /note="Similar to Bacillus licheniformis D-alanine
FT                   aminotransferase Dat SWALL:DAAA_BACLI (SWALL:P54692) (283
FT                   aa) fasta scores: E(): 5.1e-11, 29.91% id in 244 aa"
FT                   /protein_id="CAD66904.1"
FT                   /translation="MNTEYLHVLWFNPDTDCEPRFYDVHHPLIPATSDAINRGVGVFET
FT                   IGILSGRILNLDEHLERMCTSANRLGLRSIEPDRWRSLILQSAKKIADQERAGLRVVYA
FT                   RNSNRSYLAWIAAFAVRDPDALSKGIKVITLQRGVRSDAGRLYPWLLFGAKTVSYAVNM
FT                   HALEVAQARGADDAIFLSEDGLVLEGTTSNLIAYNKGAFITPCPRTMSILPGTTQKRLF
FT                   MLLEAEGKKTLETSVATEALYNSEGVWLTSSVRMITPVVSVDGNRVRFDPGLTDWLNEL
FT                   LARSAV"
     MNTEYLHVLW FNPDTDCEPR FYDVHHPLIP ATSDAINRGV GVFETIGILS GRILNLDEHL        60
     ERMCTSANRL GLRSIEPDRW RSLILQSAKK IADQERAGLR VVYARNSNRS YLAWIAAFAV       120
     RDPDALSKGI KVITLQRGVR SDAGRLYPWL LFGAKTVSYA VNMHALEVAQ ARGADDAIFL       180
     SEDGLVLEGT TSNLIAYNKG AFITPCPRTM SILPGTTQKR LFMLLEAEGK KTLETSVATE       240
     ALYNSEGVWL TSSVRMITPV VSVDGNRVRF DPGLTDWLNE LLARSAV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page