(data stored in ACNUC30630 zone)

EMBL: BX251410.PE22

BX251410.PE22        Location/Qualifiers
FT   CDS             22844..23152
FT                   /transl_table=11
FT                   /locus_tag="TW022"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66714.1"
FT                   /translation="MDFDPGKCVIGAINKVFSVDSISTTVGFTLLDKMVKVLKVSIKLT
FT                   RLINFSSIVLTAIDAVTGCLEGGIVSTETPVHPVPIVSSDCSAYDMGHKLGYRCQRR"
     MDFDPGKCVI GAINKVFSVD SISTTVGFTL LDKMVKVLKV SIKLTRLINF SSIVLTAIDA        60
     VTGCLEGGIV STETPVHPVP IVSSDCSAYD MGHKLGYRCQ RR                          102
//

If you have problems or comments...

PBIL Back to PBIL home page