(data stored in ACNUC30630 zone)

EMBL: BX251410.PE220

BX251410.PE220       Location/Qualifiers
FT   CDS             complement(259491..260606)
FT                   /transl_table=11
FT                   /locus_tag="TW235"
FT                   /product="putative MRP-family ATP-binding protein"
FT                   /note="Similar to Mycobacterium tuberculosis Mrp protein
FT                   homolog or rv1229c or mt1267 or mtci61.12c or mtv006.01C
FT                   SWALL:MRP_MYCTU (SWALL:O33225) (381 aa) fasta scores: E():
FT                   1.2e-45, 43.83% id in 365 aa"
FT                   /protein_id="CAD66912.1"
FT                   /translation="MIEKKLYSAMEKVYDPELHIPITRLGMVKTITTDSKTVSILIHIT
FT                   SPTCPAVDKIKQRVTDAASAVCPEHDIKIEIGVMSHQERQNLKEVLNLQKRSNPFKESK
FT                   TRIIAVTSGKGGVGKSTIVSNLGVGLARMGFSVSVIDADVYGFSIPRMFGIDEDFIPQR
FT                   ENGMIMPANKFGVKLISIGMFMRRRGAVAWRGPLLHRTINQFLCDVNFADPDILLIDMP
FT                   PGTGDAAITIAQLLPNSEVLVITTPQIVAADVAIRSGQFALSVKQNIIGVVENMSSCPE
FT                   SKLDIFGHGGGKFVAEFLDKQCKKESTAKDNRITNPHEAIDLITCIPLDVNIRKSGDEG
FT                   VPLLVENKYEGSPGHTALKELYEKIALKLYG"
     MIEKKLYSAM EKVYDPELHI PITRLGMVKT ITTDSKTVSI LIHITSPTCP AVDKIKQRVT        60
     DAASAVCPEH DIKIEIGVMS HQERQNLKEV LNLQKRSNPF KESKTRIIAV TSGKGGVGKS       120
     TIVSNLGVGL ARMGFSVSVI DADVYGFSIP RMFGIDEDFI PQRENGMIMP ANKFGVKLIS       180
     IGMFMRRRGA VAWRGPLLHR TINQFLCDVN FADPDILLID MPPGTGDAAI TIAQLLPNSE       240
     VLVITTPQIV AADVAIRSGQ FALSVKQNII GVVENMSSCP ESKLDIFGHG GGKFVAEFLD       300
     KQCKKESTAK DNRITNPHEA IDLITCIPLD VNIRKSGDEG VPLLVENKYE GSPGHTALKE       360
     LYEKIALKLY G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page