(data stored in ACNUC30630 zone)

EMBL: BX251410.PE221

BX251410.PE221       Location/Qualifiers
FT   CDS             complement(260614..261108)
FT                   /transl_table=11
FT                   /locus_tag="TW236"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein Rv1231c or mtv006.03c or mt1269 SWALL:O86314
FT                   (EMBL:Z98260) (180 aa) fasta scores: E(): 1.4e-09, 39.25%
FT                   id in 135 aa"
FT                   /protein_id="CAD66913.1"
FT                   /translation="MKKSSKLHTPLLTSRMRLRYNPGVFEMRTERIALYMGTASFFIFF
FT                   TTFCILWILWSNYAPNGLRFDSAEIGYPVLTLVLSVLAAYAAPLILLAEIRQWKRESLN
FT                   MKQMREMADRNIASTEYLAREVADLRLSIAQLITDQQKNNNRLKRLEETEKTIQDFGND
FT                   S"
     MKKSSKLHTP LLTSRMRLRY NPGVFEMRTE RIALYMGTAS FFIFFTTFCI LWILWSNYAP        60
     NGLRFDSAEI GYPVLTLVLS VLAAYAAPLI LLAEIRQWKR ESLNMKQMRE MADRNIASTE       120
     YLAREVADLR LSIAQLITDQ QKNNNRLKRL EETEKTIQDF GNDS                        164
//

If you have problems or comments...

PBIL Back to PBIL home page