(data stored in ACNUC30630 zone)

EMBL: BX251410.PE222

BX251410.PE222       Location/Qualifiers
FT   CDS             complement(261095..262342)
FT                   /transl_table=11
FT                   /locus_tag="TW237"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO5154 or SCP8.17c SWALL:Q9FBK4 (EMBL:AL390975)
FT                   (433 aa) fasta scores: E(): 6.5e-37, 38.06% id in 423 aa"
FT                   /protein_id="CAD66914.1"
FT                   /translation="MSKSVYISRVCGSSVLGPTGDRLGKVKDVLGTPRLRKSPRIIGMV
FT                   LEIVGKRYIFVSINRVTAIDNGYVATRGVINIQRFRRRSGEICLSQDIVGKKVSIGNNT
FT                   TARAEDIEILADPAGEWYVGKIFVRTSGNRLFSRGNTCFMHWQDISGLDQVPDYISNPE
FT                   IKAADLAADIVDMPSTDAARIVEDLPDERLADVLEEMEEPEQAKIIDALDDNRTADILE
FT                   EMQPDDAVDLIGYMSNKRKEGLLQLMEPEEARKLRLLLGFAHNTAGGMMTSDFVIVSPD
FT                   TTVAEALALIRRQEIAPALASTVCVALPPYDPPTGRFIGVVHFQALLRQPPYQKLSHII
FT                   DTSIEPVLPTIDAEKVSRILATYNLLSLPVIDDRKRLLGIITIDDVLDYVLPKNWRKNE
FT                   IDSTNNKENMVHNEKE"
     MSKSVYISRV CGSSVLGPTG DRLGKVKDVL GTPRLRKSPR IIGMVLEIVG KRYIFVSINR        60
     VTAIDNGYVA TRGVINIQRF RRRSGEICLS QDIVGKKVSI GNNTTARAED IEILADPAGE       120
     WYVGKIFVRT SGNRLFSRGN TCFMHWQDIS GLDQVPDYIS NPEIKAADLA ADIVDMPSTD       180
     AARIVEDLPD ERLADVLEEM EEPEQAKIID ALDDNRTADI LEEMQPDDAV DLIGYMSNKR       240
     KEGLLQLMEP EEARKLRLLL GFAHNTAGGM MTSDFVIVSP DTTVAEALAL IRRQEIAPAL       300
     ASTVCVALPP YDPPTGRFIG VVHFQALLRQ PPYQKLSHII DTSIEPVLPT IDAEKVSRIL       360
     ATYNLLSLPV IDDRKRLLGI ITIDDVLDYV LPKNWRKNEI DSTNNKENMV HNEKE            415
//

If you have problems or comments...

PBIL Back to PBIL home page