(data stored in ACNUC30630 zone)

EMBL: BX251410.PE224

BX251410.PE224       Location/Qualifiers
FT   CDS             263951..264562
FT                   /transl_table=11
FT                   /locus_tag="TW240"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66916.1"
FT                   /translation="MGISEAHTPHKDIHLDVGLISAQIILLRNIFSTALGNIRACDSYA
FT                   ASLIKRSESVQKCSKAPKEVFRAELVGAALSVQQLMSGRGEYVDLMSYFLISELMRDFH
FT                   LLALSHLEVSEKYRIEELTCVDLKDKKKLSREIFRLLSRIARNDSTLSSMMSLWGRRIL
FT                   GDVLLFIKLCIGQDHNNSRSLLSTLAGKHSERMRAIGLIA"
     MGISEAHTPH KDIHLDVGLI SAQIILLRNI FSTALGNIRA CDSYAASLIK RSESVQKCSK        60
     APKEVFRAEL VGAALSVQQL MSGRGEYVDL MSYFLISELM RDFHLLALSH LEVSEKYRIE       120
     ELTCVDLKDK KKLSREIFRL LSRIARNDST LSSMMSLWGR RILGDVLLFI KLCIGQDHNN       180
     SRSLLSTLAG KHSERMRAIG LIA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page