(data stored in ACNUC30630 zone)

EMBL: BX251410.PE226

BX251410.PE226       Location/Qualifiers
FT   CDS             264900..267881
FT                   /transl_table=11
FT                   /locus_tag="TW242"
FT                   /product="putative ATP-dependent DNA helicase subunit"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5183 or 2SC3B6.07
FT                   SWALL:Q9FCK5 (EMBL:AL390968) (1159 aa) fasta scores: E():
FT                   2.7e-07, 24.49% id in 1139 aa"
FT                   /protein_id="CAD66918.1"
FT                   /translation="MFMDISECSLPDAIDSIARIPEGSRVSVIGPPGSGKTSLLLSLLE
FT                   KYSESFEPEEVLVLAPGRLLANRLNGIALPALLKEKKVRSGRLVVTPASFAFRIVQNSM
FT                   KGERPTLLSGADEDQVIAETIAQNCELFKSSYARSPNFRSRMRFFIEDLSRHGIDPAHL
FT                   GKIDRWKTYAALIEKYRLARTSNNAFTAVEIIERAAQLASTGYLPYRVIMVDEAQELAA
FT                   EHMRLFSALARRNITVILFGDPDKAVARSASPSIFLDFSEKLFVLKTVFRTPRNLHLLS
FT                   QKICQGIGVTGSVLAHRQSFNSSILEGRVETVISSSRATSMADIARWFREKHLLEGIDW
FT                   EDMALIIFQRSSAEVYSHFLERFGVPVQILGGGLNLSEKPIAGAILNAIELACFPDILT
FT                   GKTLVKLLLSPIGGFDVFLMRKLTIELKRIAPKNIQVLNERLLWAFHAYRKLQTQDTDE
FT                   VYRVFLASRIGRSLKKIFECLISLERLYREDNVSLPVLIWHVYSFLNLKSAVSKEPWQT
FT                   SKVSHRVLEEVIALQKLADAVSKKDPLCSAGLILQKIINAEVPVDNLSIREKRGCVTIL
FT                   TPASSVGYEYRAVVITDIQGSHKMDSTQLDPELALADINNIPFSRYLESKLAGRRHNLL
FT                   RTLYQAVTRSTSDLLVSVIDSAETSPSWLFYAFFSDYPSCELSSLPLTLRGIVTQLRLD
FT                   LERDPGNTEAASALRLLAKEGISQADPQNWYGYLSRTENKSYVMDSIKPSALDKFHTCP
FT                   LGWFTDQLDCNRYPGNATEIGTIIHRCMQELTCDNRQPNLNEFLDYAYAKLREADFESR
FT                   WVLEREKKRLVGIIRKLVDYLIDFDAHGGTLLASEKSFSFDLNVFKDRSIMISGQIDRL
FT                   ERLSSGEIRIVDLKTGSSLLSKNDAESNLQLSAYQLAVEHLDIVYETLPSAMLIYPAVG
FT                   TKKAAIRIKGPMDRDSKRVLKNTIRDLLLQNESFTLTAALEEHCESRTACKKLMVPHVS
FT                   FSVK"
     MFMDISECSL PDAIDSIARI PEGSRVSVIG PPGSGKTSLL LSLLEKYSES FEPEEVLVLA        60
     PGRLLANRLN GIALPALLKE KKVRSGRLVV TPASFAFRIV QNSMKGERPT LLSGADEDQV       120
     IAETIAQNCE LFKSSYARSP NFRSRMRFFI EDLSRHGIDP AHLGKIDRWK TYAALIEKYR       180
     LARTSNNAFT AVEIIERAAQ LASTGYLPYR VIMVDEAQEL AAEHMRLFSA LARRNITVIL       240
     FGDPDKAVAR SASPSIFLDF SEKLFVLKTV FRTPRNLHLL SQKICQGIGV TGSVLAHRQS       300
     FNSSILEGRV ETVISSSRAT SMADIARWFR EKHLLEGIDW EDMALIIFQR SSAEVYSHFL       360
     ERFGVPVQIL GGGLNLSEKP IAGAILNAIE LACFPDILTG KTLVKLLLSP IGGFDVFLMR       420
     KLTIELKRIA PKNIQVLNER LLWAFHAYRK LQTQDTDEVY RVFLASRIGR SLKKIFECLI       480
     SLERLYREDN VSLPVLIWHV YSFLNLKSAV SKEPWQTSKV SHRVLEEVIA LQKLADAVSK       540
     KDPLCSAGLI LQKIINAEVP VDNLSIREKR GCVTILTPAS SVGYEYRAVV ITDIQGSHKM       600
     DSTQLDPELA LADINNIPFS RYLESKLAGR RHNLLRTLYQ AVTRSTSDLL VSVIDSAETS       660
     PSWLFYAFFS DYPSCELSSL PLTLRGIVTQ LRLDLERDPG NTEAASALRL LAKEGISQAD       720
     PQNWYGYLSR TENKSYVMDS IKPSALDKFH TCPLGWFTDQ LDCNRYPGNA TEIGTIIHRC       780
     MQELTCDNRQ PNLNEFLDYA YAKLREADFE SRWVLEREKK RLVGIIRKLV DYLIDFDAHG       840
     GTLLASEKSF SFDLNVFKDR SIMISGQIDR LERLSSGEIR IVDLKTGSSL LSKNDAESNL       900
     QLSAYQLAVE HLDIVYETLP SAMLIYPAVG TKKAAIRIKG PMDRDSKRVL KNTIRDLLLQ       960
     NESFTLTAAL EEHCESRTAC KKLMVPHVSF SVK                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page