(data stored in ACNUC30630 zone)

EMBL: BX251410.PE227

BX251410.PE227       Location/Qualifiers
FT   CDS             267878..270799
FT                   /transl_table=11
FT                   /locus_tag="TW243"
FT                   /product="putative ATP-dependent DNA helicase subunit"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5184 or 2SC3B6.08
FT                   SWALL:Q9FCK4 (EMBL:AL390968) (1222 aa) fasta scores: E():
FT                   9.9e-16, 26.61% id in 1161 aa, and to Escherichia coli DNA
FT                   helicase II UvrB or MutU or PdeB or Rad or Recl or b3813
FT                   SWALL:UVRD_ECOLI (SWALL:P03018) (720 aa) fasta scores: E():
FT                   2.8e-09, 24.25% id in 800 aa"
FT                   /protein_id="CAD66919.1"
FT                   /translation="MNMSLRDSRHMCSILNLHAPTEEQRAIIESPLENALVIAGAGSGK
FT                   TETLVLRLLWLIASGKLKPESIMGLTFTRKAAGELASRLQKSLAILNSYTGDVLSPEID
FT                   VLTYNSFANSIYQDNALLLDHPVPYTAIEDSEAQLIARRLLVEHGLDEDEPSETIDNLA
FT                   SSLIKLDDAIVDNLLDLGELNQFASEFIEFVGAFDAPVAKSDVFRAKRLIALSKLIPAL
FT                   KDEKKLRGRISYSEQVAFALEVCRQTHVLAEFQEKIAYVVLDEYQDTSPIQVEFLKTIF
FT                   GNRCRVLAVGDPRQAIFGFRGASVANIANFARDFVSNKQYELSISWRNDKNILDLANHI
FT                   SPKIRPLHPRPEANDGSTSLEVYTDPEQEVHEGALWLNSVVEKGTAAVLTRTRSRLISV
FT                   SRVLDEIGVSYTRADVNIFYEPGVVDILSCMRIISGVNENLSFLRLITGPRWQVGISDL
FT                   HALRGYIAVGKKNLDRISLLEAVNRINIQKTPMSCEGKKRLEDFLEFFRKIKGLSFLSP
FT                   LELAYLIEESLNLDIEVQMSHRGRENLDALYELIASFRGDNLSEMLAWFDSLEEEDAFR
FT                   GPIKQSCPGQVELFTVHSAKGLEWDWVLLPFLDDFPAKSREKSGWLSKTGLLPFCLRLD
FT                   RESLPEFYFHKCSDSKEYRAARRQYEDDVLQHQIREERKLLYVAVTRARQGLRISASAR
FT                   QKPGQFLREISEFLQTDLPQAVHNNPKKRVGYWPLDSLGARRKRVKLAAAAVHNRSIEE
FT                   SEESLKKEPLKALIAGMLKELDISVDKPEKRISATALSKKDPNVFLLPQPPIKNAWLGV
FT                   AFHAWIENYYSTYSDMLFHENSADEYGISGPVFEQSQRFSPELDQLRHNFMQSEWSYKK
FT                   PIAVELSLEWLIGDVIVPCTIDAVFFDGDRYTILDWKSGLSSNQYRIQLSLYRLAFAEW
FT                   KGVNPDKVEAKIYFAADNRTIKVRPYTVDELGKMPGFLSDLFS"
     MNMSLRDSRH MCSILNLHAP TEEQRAIIES PLENALVIAG AGSGKTETLV LRLLWLIASG        60
     KLKPESIMGL TFTRKAAGEL ASRLQKSLAI LNSYTGDVLS PEIDVLTYNS FANSIYQDNA       120
     LLLDHPVPYT AIEDSEAQLI ARRLLVEHGL DEDEPSETID NLASSLIKLD DAIVDNLLDL       180
     GELNQFASEF IEFVGAFDAP VAKSDVFRAK RLIALSKLIP ALKDEKKLRG RISYSEQVAF       240
     ALEVCRQTHV LAEFQEKIAY VVLDEYQDTS PIQVEFLKTI FGNRCRVLAV GDPRQAIFGF       300
     RGASVANIAN FARDFVSNKQ YELSISWRND KNILDLANHI SPKIRPLHPR PEANDGSTSL       360
     EVYTDPEQEV HEGALWLNSV VEKGTAAVLT RTRSRLISVS RVLDEIGVSY TRADVNIFYE       420
     PGVVDILSCM RIISGVNENL SFLRLITGPR WQVGISDLHA LRGYIAVGKK NLDRISLLEA       480
     VNRINIQKTP MSCEGKKRLE DFLEFFRKIK GLSFLSPLEL AYLIEESLNL DIEVQMSHRG       540
     RENLDALYEL IASFRGDNLS EMLAWFDSLE EEDAFRGPIK QSCPGQVELF TVHSAKGLEW       600
     DWVLLPFLDD FPAKSREKSG WLSKTGLLPF CLRLDRESLP EFYFHKCSDS KEYRAARRQY       660
     EDDVLQHQIR EERKLLYVAV TRARQGLRIS ASARQKPGQF LREISEFLQT DLPQAVHNNP       720
     KKRVGYWPLD SLGARRKRVK LAAAAVHNRS IEESEESLKK EPLKALIAGM LKELDISVDK       780
     PEKRISATAL SKKDPNVFLL PQPPIKNAWL GVAFHAWIEN YYSTYSDMLF HENSADEYGI       840
     SGPVFEQSQR FSPELDQLRH NFMQSEWSYK KPIAVELSLE WLIGDVIVPC TIDAVFFDGD       900
     RYTILDWKSG LSSNQYRIQL SLYRLAFAEW KGVNPDKVEA KIYFAADNRT IKVRPYTVDE       960
     LGKMPGFLSD LFS                                                          973
//

If you have problems or comments...

PBIL Back to PBIL home page