(data stored in ACNUC30630 zone)

EMBL: BX251410.PE228

BX251410.PE228       Location/Qualifiers
FT   CDS             complement(270823..271998)
FT                   /transl_table=11
FT                   /locus_tag="TW244"
FT                   /product="putative transferase"
FT                   /note="Weakly similar to Escherichia coli macrolide
FT                   2'-phosphotransferase I MphA SWALL:Q47396 (EMBL:D16251)
FT                   (301 aa) fasta scores: E(): 1.4e-07, 26.1% id in 226 aa"
FT                   /protein_id="CAD66920.1"
FT                   /translation="MIALSPMSMAAVAVATLPNLNVLQVARGTSDSHHVDSILRCDDNR
FT                   WMLIRVPLSQNAKDKMARLVKNLRALSKGVRARLPFSIPNVLAYQPVKLSSGMNMTLIM
FT                   DHPQGYALRDIKPGEGAATSIGWAIAAIHNLPSGLLISAGYTHKTAQDCRYEVIDFVDK
FT                   ANATNMLPGSLKEKWETLVEDEDLWKFQTTVVKKNFSMDSFRFQDNQEGESSVCAILEW
FT                   EDASIDDPAYDLHWLNQLSHESAESILKAYEAFSTTTHDRGCLERAKLYAELDIARILI
FT                   DGVREEKHELIDMAKRLLLELDRTSAQEDTPKQAIHKAEGLLENAQNLSFEQQRSYEIQ
FT                   SDDVNAYSDEETYKSDQVSDSGISENLRNIEEFLGSAKTNTEEENSEAKNE"
     MIALSPMSMA AVAVATLPNL NVLQVARGTS DSHHVDSILR CDDNRWMLIR VPLSQNAKDK        60
     MARLVKNLRA LSKGVRARLP FSIPNVLAYQ PVKLSSGMNM TLIMDHPQGY ALRDIKPGEG       120
     AATSIGWAIA AIHNLPSGLL ISAGYTHKTA QDCRYEVIDF VDKANATNML PGSLKEKWET       180
     LVEDEDLWKF QTTVVKKNFS MDSFRFQDNQ EGESSVCAIL EWEDASIDDP AYDLHWLNQL       240
     SHESAESILK AYEAFSTTTH DRGCLERAKL YAELDIARIL IDGVREEKHE LIDMAKRLLL       300
     ELDRTSAQED TPKQAIHKAE GLLENAQNLS FEQQRSYEIQ SDDVNAYSDE ETYKSDQVSD       360
     SGISENLRNI EEFLGSAKTN TEEENSEAKN E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page