(data stored in ACNUC30630 zone)

EMBL: BX251410.PE229

BX251410.PE229       Location/Qualifiers
FT   CDS             272079..273836
FT                   /transl_table=11
FT                   /locus_tag="TW245"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5188 or 2SC3B6.12
FT                   SWALL:Q9FCK0 (EMBL:AL390968) (785 aa) fasta scores: E():
FT                   2.7e-40, 35.14% id in 606 aa, and to Escherichia coli DNA
FT                   helicase II UvrD or MutU or PdeB or Rad or Recl or b3813
FT                   SWALL:UVRD_ECOLI (SWALL:P03018) (720 aa) fasta scores: E():
FT                   1.5e-19, 25.47% id in 636 aa"
FT                   /protein_id="CAD66921.1"
FT                   /translation="MTIDVFSGLSDQQCDAVRTLRGPVKIIAGAGSGKTLTITRRIVNG
FT                   IISNEYDSGHVMALSFTRRASMQLRSRLVEHGVKGVYSGTFHSAALSQLRFFWETFHGK
FT                   PPRQIIRDKVNLLRDAARGINFSFSDESLCQVASEIEWAKQNGYDLSGYDKCNHRISGM
FT                   SASQARTLMLAYEDVKNNRRLIDFEDILSLTVGMLSVQPRAVARVRDRFRVFLIDEFQD
FT                   VSPLQFELLRIWLGRRRDICVVGDPNQCIYSFAGAKRDYLVKFADYFPGAREVFLSRNY
FT                   RSRPEIVCLSRHIIDSHSPDIGLYQPTEGISRNYADTKTATPAQDMRVNAGNRAKCHCT
FT                   APPGTKGAVRCGNSDLGYRETPIRWHTFENQIQEMHFIAQSLKNISQSCAVLYRTAIQG
FT                   ERLAKYLHTSGIIYRSQESRLFHETDVAQIACKRVIEKTIECNVRVVDLVDSVVSGIFP
FT                   RKPDALTGEYDGWVALQALRLCARRFNGNASSFATYLLEMQRHRREPEMPFATLATLHS
FT                   TKGLEWDTVYIIGVNEGLIPHHTGDEDEEKRLFYVGVTRARKNIVFSSTRTPSRYLTEL
FT                   CLSPISAKE"
     MTIDVFSGLS DQQCDAVRTL RGPVKIIAGA GSGKTLTITR RIVNGIISNE YDSGHVMALS        60
     FTRRASMQLR SRLVEHGVKG VYSGTFHSAA LSQLRFFWET FHGKPPRQII RDKVNLLRDA       120
     ARGINFSFSD ESLCQVASEI EWAKQNGYDL SGYDKCNHRI SGMSASQART LMLAYEDVKN       180
     NRRLIDFEDI LSLTVGMLSV QPRAVARVRD RFRVFLIDEF QDVSPLQFEL LRIWLGRRRD       240
     ICVVGDPNQC IYSFAGAKRD YLVKFADYFP GAREVFLSRN YRSRPEIVCL SRHIIDSHSP       300
     DIGLYQPTEG ISRNYADTKT ATPAQDMRVN AGNRAKCHCT APPGTKGAVR CGNSDLGYRE       360
     TPIRWHTFEN QIQEMHFIAQ SLKNISQSCA VLYRTAIQGE RLAKYLHTSG IIYRSQESRL       420
     FHETDVAQIA CKRVIEKTIE CNVRVVDLVD SVVSGIFPRK PDALTGEYDG WVALQALRLC       480
     ARRFNGNASS FATYLLEMQR HRREPEMPFA TLATLHSTKG LEWDTVYIIG VNEGLIPHHT       540
     GDEDEEKRLF YVGVTRARKN IVFSSTRTPS RYLTELCLSP ISAKE                       585
//

If you have problems or comments...

PBIL Back to PBIL home page