(data stored in ACNUC30630 zone)

EMBL: BX251410.PE23

BX251410.PE23        Location/Qualifiers
FT   CDS             23168..23563
FT                   /transl_table=11
FT                   /locus_tag="TW023"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66715.1"
FT                   /translation="MWRKLASVPALIIYLAFVPVLTVAAEIYVLTGYSLPWLGIPAFAL
FT                   VIITINSGLLPNRDVSPSRLARLAVYLALAALIVFVVVCMTIYFTVGLSRLARFDVLAP
FT                   FVLGYLLASALSVELCYKLKAKKSGKV"
     MWRKLASVPA LIIYLAFVPV LTVAAEIYVL TGYSLPWLGI PAFALVIITI NSGLLPNRDV        60
     SPSRLARLAV YLALAALIVF VVVCMTIYFT VGLSRLARFD VLAPFVLGYL LASALSVELC       120
     YKLKAKKSGK V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page