(data stored in ACNUC30630 zone)

EMBL: BX251410.PE230

BX251410.PE230       Location/Qualifiers
FT   CDS             complement(273875..275149)
FT                   /transl_table=11
FT                   /locus_tag="TW246"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO5199 or 2SC3B6.23c SWALL:Q9FCI9 (EMBL:AL390968)
FT                   (487 aa) fasta scores: E(): 1.7e-38, 32.7% id in 425 aa"
FT                   /protein_id="CAD66922.1"
FT                   /translation="MIHEDDGNEGLPPWMQGGIFLPNIIGPVKNPELQVLRQAEQVINT
FT                   VPKVQIDSDTRERLIKNIDVANLWLSEASSLTEVKVPCEILTRDEWVRNTARGWLDLTS
FT                   PISSVIASKLIQQAQHNLPESLKPLISQLSQAMQQVSKASLLVQVGNAAGNLSLEVLSG
FT                   CDVGIPLLESPKALIVAENVVKFASDFHLPLDEAGIYLACREIAYACILQHCAWIKSRI
FT                   FTSIHSFSKSMSVDNELMDINDMHFDAASALTQITGTIKFEPNEQQLNALRVLEDQLAI
FT                   LEGWVSIVTTIATSRLPHAGAINETIVRRRAGGGPAEKALSSLIGIDLHPRRLRASQSM
FT                   WNKITQTVGPYKRDSLWGHPDLVPTSHDIDDPEGLIKRLSENKSDKIDDELSRLLDSEI
FT                   ERNVKNSTGDDEGDTNSNGKDASKS"
     MIHEDDGNEG LPPWMQGGIF LPNIIGPVKN PELQVLRQAE QVINTVPKVQ IDSDTRERLI        60
     KNIDVANLWL SEASSLTEVK VPCEILTRDE WVRNTARGWL DLTSPISSVI ASKLIQQAQH       120
     NLPESLKPLI SQLSQAMQQV SKASLLVQVG NAAGNLSLEV LSGCDVGIPL LESPKALIVA       180
     ENVVKFASDF HLPLDEAGIY LACREIAYAC ILQHCAWIKS RIFTSIHSFS KSMSVDNELM       240
     DINDMHFDAA SALTQITGTI KFEPNEQQLN ALRVLEDQLA ILEGWVSIVT TIATSRLPHA       300
     GAINETIVRR RAGGGPAEKA LSSLIGIDLH PRRLRASQSM WNKITQTVGP YKRDSLWGHP       360
     DLVPTSHDID DPEGLIKRLS ENKSDKIDDE LSRLLDSEIE RNVKNSTGDD EGDTNSNGKD       420
     ASKS                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page