(data stored in ACNUC30630 zone)

EMBL: BX251410.PE232

BX251410.PE232       Location/Qualifiers
FT   CDS             276892..277263
FT                   /transl_table=11
FT                   /locus_tag="TW248"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO1749 or 2SCI34.02 SWALL:Q9EWX7 (EMBL:AL445403)
FT                   (146 aa) fasta scores: E(): 3.5e-07, 35.33% id in 133 aa"
FT                   /db_xref="GOA:Q83I43"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I43"
FT                   /protein_id="CAD66924.1"
FT                   /translation="MAGGLKKAMVYLGLAEDNQELHSAPSGMSHLRRVPHPKQQMSEIF
FT                   TFHPKKYSEVSGIVERFRQNIPVIIDMSQLSDTDARRMIDFASGLSQGLVGKIERVVGK
FT                   VFLLSPEHISISTESKKEE"
     MAGGLKKAMV YLGLAEDNQE LHSAPSGMSH LRRVPHPKQQ MSEIFTFHPK KYSEVSGIVE        60
     RFRQNIPVII DMSQLSDTDA RRMIDFASGL SQGLVGKIER VVGKVFLLSP EHISISTESK       120
     KEE                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page