(data stored in ACNUC30630 zone)

EMBL: BX251410.PE233

BX251410.PE233       Location/Qualifiers
FT   CDS             277348..277875
FT                   /transl_table=11
FT                   /locus_tag="TW249"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Bacillus subtilis minicell-associated
FT                   protein DivIVA SWALL:P71021 (EMBL:U60901) (164 aa) fasta
FT                   scores: E(): 0.031, 27.32% id in 161 aa"
FT                   /protein_id="CAD66925.1"
FT                   /translation="MVLSPSDIVNKRFGVTKFREGYDQDEVDDYLDEVAVDLRHLLERN
FT                   DELSSELESARGQIQALKDELAEASRGASGGSFGDQAAEILALAKRARDEYIQEGVKRR
FT                   DAIVAEARESAERAARTSESELTRRVEALKLEIPALEKRVLDLRAFESDYRDRLRAFLQ
FT                   SGLRDLEPKNPS"
     MVLSPSDIVN KRFGVTKFRE GYDQDEVDDY LDEVAVDLRH LLERNDELSS ELESARGQIQ        60
     ALKDELAEAS RGASGGSFGD QAAEILALAK RARDEYIQEG VKRRDAIVAE ARESAERAAR       120
     TSESELTRRV EALKLEIPAL EKRVLDLRAF ESDYRDRLRA FLQSGLRDLE PKNPS            175
//

If you have problems or comments...

PBIL Back to PBIL home page