(data stored in ACNUC30630 zone)

EMBL: BX251410.PE235

BX251410.PE235       Location/Qualifiers
FT   CDS             278405..279316
FT                   /transl_table=11
FT                   /locus_tag="TW251"
FT                   /product="putative pseudouridine synthase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ribosomal large subunit pseudouridine synthase SCO2073 or
FT                   SC4A10.06c SWALL:Q9S2X8 (EMBL:AL109663) (314 aa) fasta
FT                   scores: E(): 2.5e-42, 49.55% id in 224 aa"
FT                   /protein_id="CAD66927.1"
FT                   /translation="MSRSCVARAISLGEITRQNVSDKRLTKSDLASGVYVWNRHALHTS
FT                   GEDSAAPDSVHFSSTLDSCCLDPCASTRDLLRVIYSDDDLFVIDKPAGVAAHASPGWCG
FT                   PTVTGCLSGLLAACGPQDRQGVVHRLDANTSGLMVLAKSDLAYHNLKAAFRDRAIHKRY
FT                   KALVQGYPDPSSGVINAPIGRDLKHRDRFCIDYSGRDAVTQYSTEEVYPGFTLLSVAPK
FT                   TGRTHQIRVHFSALRHPLVGDVKYGADPVFSQKVNLKRQWLHAYHLSFTHPVSGVFVEF
FT                   ESRIHEDLQESLRILSKIYDGS"
     MSRSCVARAI SLGEITRQNV SDKRLTKSDL ASGVYVWNRH ALHTSGEDSA APDSVHFSST        60
     LDSCCLDPCA STRDLLRVIY SDDDLFVIDK PAGVAAHASP GWCGPTVTGC LSGLLAACGP       120
     QDRQGVVHRL DANTSGLMVL AKSDLAYHNL KAAFRDRAIH KRYKALVQGY PDPSSGVINA       180
     PIGRDLKHRD RFCIDYSGRD AVTQYSTEEV YPGFTLLSVA PKTGRTHQIR VHFSALRHPL       240
     VGDVKYGADP VFSQKVNLKR QWLHAYHLSF THPVSGVFVE FESRIHEDLQ ESLRILSKIY       300
     DGS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page