(data stored in ACNUC30630 zone)

EMBL: BX251410.PE239

BX251410.PE239       Location/Qualifiers
FT   CDS             285371..286027
FT                   /transl_table=11
FT                   /locus_tag="TW255"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   27.0 kDa protein Rv2182c or mtv021.15c or mt2237
FT                   SWALL:O53516 (EMBL:AL021957) (247 aa) fasta scores: E():
FT                   6.9e-07, 26.92% id in 208 aa"
FT                   /protein_id="CAD66931.1"
FT                   /translation="MFRYTLRGNVPLRGPVIIVANHNSELDPILFAIAIWRMGRKPYFM
FT                   AKRQLFSVPALGACLRFLRQIPVTRPSDTPCGDMTENTHAPSLLTAIRRLRAGGVIVLY
FT                   PEGSVTRHPELWLDSFNPGFVHLASLTGTPIICAAQWGAQKTLPYGKKLPKFGLRNAYS
FT                   VVFCAPVHIPRKRLSDEEIKRFSNLMKEKINTALAAIRLSDETGFMRHERGWVAQ"
     MFRYTLRGNV PLRGPVIIVA NHNSELDPIL FAIAIWRMGR KPYFMAKRQL FSVPALGACL        60
     RFLRQIPVTR PSDTPCGDMT ENTHAPSLLT AIRRLRAGGV IVLYPEGSVT RHPELWLDSF       120
     NPGFVHLASL TGTPIICAAQ WGAQKTLPYG KKLPKFGLRN AYSVVFCAPV HIPRKRLSDE       180
     EIKRFSNLMK EKINTALAAI RLSDETGFMR HERGWVAQ                               218
//

If you have problems or comments...

PBIL Back to PBIL home page