(data stored in ACNUC30630 zone)

EMBL: BX251410.PE24

BX251410.PE24        Location/Qualifiers
FT   CDS             23661..23798
FT                   /transl_table=11
FT                   /locus_tag="TW024"
FT                   /product="putative integral membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66716.1"
FT                   /translation="MAYELHNLLHCAVPYDLLVFSRYIAFTVVAVSPIFWLIPGNYALL
FT                   "
     MAYELHNLLH CAVPYDLLVF SRYIAFTVVA VSPIFWLIPG NYALL                        45
//

If you have problems or comments...

PBIL Back to PBIL home page