(data stored in ACNUC30630 zone)

EMBL: BX251410.PE242

BX251410.PE242       Location/Qualifiers
FT   CDS             complement(288036..288500)
FT                   /transl_table=11
FT                   /locus_tag="TW258"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Weakly similar to Streptomyces coelicolor
FT                   hypothetical protein SCO3628 or SCH10.06c SWALL:Q9X8P5
FT                   (EMBL:AL049754) (163 aa) fasta scores: E(): 3.8e-07, 32.79%
FT                   id in 125 aa"
FT                   /protein_id="CAD66934.1"
FT                   /translation="MGVSCKTVCAFIVSSALFGCSTAIVLEPAQSANNPNCAAVTVRLP
FT                   QVLGNLVSRKTTAQATAAWGEPLGAVLRCGLPVQKPTTELCVSVNNVDWVINDKFNTNI
FT                   HGVKFNVRAVTYGRSPAAEVFLDNFKISPATALATLGLAVNYLPKVASCS"
     MGVSCKTVCA FIVSSALFGC STAIVLEPAQ SANNPNCAAV TVRLPQVLGN LVSRKTTAQA        60
     TAAWGEPLGA VLRCGLPVQK PTTELCVSVN NVDWVINDKF NTNIHGVKFN VRAVTYGRSP       120
     AAEVFLDNFK ISPATALATL GLAVNYLPKV ASCS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page