(data stored in ACNUC30630 zone)

EMBL: BX251410.PE243

BX251410.PE243       Location/Qualifiers
FT   CDS             complement(288527..289912)
FT                   /transl_table=11
FT                   /locus_tag="TW259"
FT                   /product="putative lipoamide acyltransferase"
FT                   /note="Similar to Bacillus subtilis lipoamide
FT                   acyltransferase component of branched-chain alpha-keto acid
FT                   dehydrogenase complex BfmB SWALL:ODB2_BACSU (SWALL:P37942)
FT                   (424 aa) fasta scores: E(): 1.6e-33, 34.64% id in 459 aa,
FT                   and to Streptomyces seoulensis dihydrolipoamide
FT                   acetyltransferase PdhB SWALL:Q9Z6I4 (EMBL:AF047034) (612
FT                   aa) fasta scores: E(): 1.3e-48, 41.3% id in 477 aa"
FT                   /protein_id="CAD66935.1"
FT                   /translation="MSEDFILPALGESVSECVITRWLKEAGDRVEVDEPLVEVSTDKVD
FT                   TELPSTLTGILEEILVQRDETAKPGQILARIAVDKDETKSNFDHGVKQSDVITGDSAGN
FT                   LLGNTRPIEDNEWPVTLHTAESKPDLSAKADHIGDEGDKQGNLYAAHNAEIPYATPIVR
FT                   QLARKLNIDLTNIVGSGVGNRILREDVLLASNRTTNTSTECAQNIPSSPEHDKSAASFD
FT                   SEVSELRGTRIKMSRLRNIIAERAVHSMQNTAQLSTVIEVDLTRIVDYRNSIKEKFKEA
FT                   EGVNLTVLPFIINATVQALRKYPVINSHIVDDQIVFPDYENISLAVDTERGLLTPVIKN
FT                   AGDMTVAQFAKSVFDLARRARNNKLSPDELTGGTFTVTNTGSRGALFDTPVVFLPQLAI
FT                   LGIGAIARRPVIVLDAQGNECISIRSVAFFALSYDHRVIDGADAARFLGYIKSLLETGN
FT                   CTV"
     MSEDFILPAL GESVSECVIT RWLKEAGDRV EVDEPLVEVS TDKVDTELPS TLTGILEEIL        60
     VQRDETAKPG QILARIAVDK DETKSNFDHG VKQSDVITGD SAGNLLGNTR PIEDNEWPVT       120
     LHTAESKPDL SAKADHIGDE GDKQGNLYAA HNAEIPYATP IVRQLARKLN IDLTNIVGSG       180
     VGNRILREDV LLASNRTTNT STECAQNIPS SPEHDKSAAS FDSEVSELRG TRIKMSRLRN       240
     IIAERAVHSM QNTAQLSTVI EVDLTRIVDY RNSIKEKFKE AEGVNLTVLP FIINATVQAL       300
     RKYPVINSHI VDDQIVFPDY ENISLAVDTE RGLLTPVIKN AGDMTVAQFA KSVFDLARRA       360
     RNNKLSPDEL TGGTFTVTNT GSRGALFDTP VVFLPQLAIL GIGAIARRPV IVLDAQGNEC       420
     ISIRSVAFFA LSYDHRVIDG ADAARFLGYI KSLLETGNCT V                           461
//

If you have problems or comments...

PBIL Back to PBIL home page