(data stored in ACNUC30630 zone)

EMBL: BX251410.PE248

BX251410.PE248       Location/Qualifiers
FT   CDS             297309..298694
FT                   /transl_table=11
FT                   /locus_tag="TW264"
FT                   /product="conserved hypothetical protein (possible murein
FT                   ligase)"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   43.4 kDa protein Rv3712 or mtv025.060 or mt3815
FT                   SWALL:O69679 (EMBL:AL022121) (413 aa) fasta scores: E():
FT                   1.4e-18, 31.18% id in 388 aa. Weak similarity to murein
FT                   ligases."
FT                   /protein_id="CAD66940.1"
FT                   /translation="MRGCLAIFFGRALLVALRVLRSGGSVLPGVLAEFISPGILIRLIG
FT                   NSEIIFVTGSNGKTSTTRMAVSILRAHGHEVFTNSSGANMKYGIIASLLAVPKRTRKGI
FT                   ALLEVDEGHIETLADLLKPSTALFLNLQVDQLNRFHDPGTVLVKLKNSLAFVKDVLIFN
FT                   LNEPCFSELLESSLASQKLSVYGFSSSSDILNSIPPTGLLPHLRGQFSPPGRIESLCHI
FT                   EHYSARTAHFSIQGVDRLQEIQLRTEGVHHAQNAAAAFALCMKILGDEFDPNKASSAVS
FT                   LSTPAFGRDQVISLAGQPVRILLMKNPRSMQVNLESIAAGSRVMIGIDGGTPDPSWLYD
FT                   VNLSDIKRAVVTGSMAWQVALALSYAGVVIDLVEPNLFRATNYFLRHSSSDKFQSFYNK
FT                   KSEVLRKSNFDNNQCVTATHLDADFNRDQFGAKDDSAMVMILNYEMSMRLLRHYRYLDS
FT                   SCY"
     MRGCLAIFFG RALLVALRVL RSGGSVLPGV LAEFISPGIL IRLIGNSEII FVTGSNGKTS        60
     TTRMAVSILR AHGHEVFTNS SGANMKYGII ASLLAVPKRT RKGIALLEVD EGHIETLADL       120
     LKPSTALFLN LQVDQLNRFH DPGTVLVKLK NSLAFVKDVL IFNLNEPCFS ELLESSLASQ       180
     KLSVYGFSSS SDILNSIPPT GLLPHLRGQF SPPGRIESLC HIEHYSARTA HFSIQGVDRL       240
     QEIQLRTEGV HHAQNAAAAF ALCMKILGDE FDPNKASSAV SLSTPAFGRD QVISLAGQPV       300
     RILLMKNPRS MQVNLESIAA GSRVMIGIDG GTPDPSWLYD VNLSDIKRAV VTGSMAWQVA       360
     LALSYAGVVI DLVEPNLFRA TNYFLRHSSS DKFQSFYNKK SEVLRKSNFD NNQCVTATHL       420
     DADFNRDQFG AKDDSAMVMI LNYEMSMRLL RHYRYLDSSC Y                           461
//

If you have problems or comments...

PBIL Back to PBIL home page