(data stored in ACNUC30630 zone)

EMBL: BX251410.PE249

BX251410.PE249       Location/Qualifiers
FT   CDS             298685..299464
FT                   /transl_table=11
FT                   /locus_tag="TW265"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weakly similar to many eg. Staphylococcus aureus
FT                   hypothetical protein sav1891 sav1891 or sa1707 or mw1832
FT                   SWALL:Q99SZ5 (EMBL:AP003363) (243 aa) fasta scores: E():
FT                   9e-10, 25.12% id in 203 aa"
FT                   /protein_id="CAD66941.1"
FT                   /translation="MLLVDLFPHQLSIRGDRGNVTALKARAHFAGHKLEIYDLHPGNVL
FT                   PTGVSGVVIGSGPDYVLADLLGDMRRLACDLKALRDDNVPFLAISNGLRLLSEKFVSHD
FT                   DVEHTAAGVYPISCHRIRRRVGESIVKCDFGELVGFENHDIEITDNEHPLGYGLDSRGT
FT                   FSRPHGFFLGNLMACFLHGAFLPLNPIVADWFLSRMGGCATAHSVDNDCNPKQSCDNRY
FT                   CCAQPSATDLDFYSHMARRVIKKRVTRAIRYKFIPGK"
     MLLVDLFPHQ LSIRGDRGNV TALKARAHFA GHKLEIYDLH PGNVLPTGVS GVVIGSGPDY        60
     VLADLLGDMR RLACDLKALR DDNVPFLAIS NGLRLLSEKF VSHDDVEHTA AGVYPISCHR       120
     IRRRVGESIV KCDFGELVGF ENHDIEITDN EHPLGYGLDS RGTFSRPHGF FLGNLMACFL       180
     HGAFLPLNPI VADWFLSRMG GCATAHSVDN DCNPKQSCDN RYCCAQPSAT DLDFYSHMAR       240
     RVIKKRVTRA IRYKFIPGK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page