(data stored in ACNUC30630 zone)

EMBL: BX251410.PE255

BX251410.PE255       Location/Qualifiers
FT   CDS             complement(307631..310096)
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="TW273"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Clostridium acetobutylicum DNA gyrase
FT                   subunit A GyrA or cac0007 SWALL:GYRA_CLOAB (SWALL:P94605)
FT                   (830 aa) fasta scores: E(): 7.6e-93, 36.54% id in 799 aa"
FT                   /protein_id="CAD66947.1"
FT                   /translation="MDKDIPEIFDVISDNEKITDVDLLHQMQDSFLEYAYSVIHSRALP
FT                   DARDGLKPVQRRILYTMSRMGLSPDKAHVKCARVTGEVMGKLHPHGDAAIYDTLVRMSQ
FT                   DFTMRIPLIDGHGNFGSLNDGPAASRYTEARLSRAAVAMINDLESNVVDFVPNYDNQFT
FT                   QPEVLPALLPNLIVNGSSGIAVGMATSIPPHNLQETVRAAIYLVRNRQSSLEQIMKILP
FT                   GPDFPTGSIIVGKEAFKEIYATGKGSFKIRAKISIDYAGIGHTNLVITELPYMVGSERV
FT                   IEKIKQGVNAHRIDGILDVTDLSDRKNGLKLVIGIKPNFSPNEVMDNLYRHTPLEESFS
FT                   VNSVALIDGKPKTLGMLDMLKVFIDHRVCVITRRSKFYLATHKKRLHMIDGLLLALVDI
FT                   DKTISIIRNSEGIKEARKNLMKCLNVTRDQAEYILDIRLNMLTKLSTIKLQSEQEELRK
FT                   TTQDLEEILSDPNKIDAILIDELKKVAQRLPSPRRTILESSVKSKKQKTDYPRQVVLTT
FT                   NGFIFTIEVNNDLISELSQPETFDMTFNTHSEPLRVVKSSIVCGVRSRIGALTSAGKVI
FT                   PFTPIGLPVLDSGFVTAKSFLGLENDEEAVLLFELHQKESLAIATSSGIVKRVTPAIWP
FT                   DRTERVITLSAGDRVVGAARGVSSCGYFVFITAKGNLLHYSAGLVNPQNRPARGVAGVT
FT                   LKDDDDRVISFGYTEDVDRANVLTVSKRMTTSRLSSYQTRGRATRGVQCHKFLKGEEWL
FT                   HAAIVGENLAAIDNLGNVVAIGKSSVTAKSCAGVKQYRLPQEKSGKSKREDRLIRYLGY
FT                   PFVHGNDTY"
     MDKDIPEIFD VISDNEKITD VDLLHQMQDS FLEYAYSVIH SRALPDARDG LKPVQRRILY        60
     TMSRMGLSPD KAHVKCARVT GEVMGKLHPH GDAAIYDTLV RMSQDFTMRI PLIDGHGNFG       120
     SLNDGPAASR YTEARLSRAA VAMINDLESN VVDFVPNYDN QFTQPEVLPA LLPNLIVNGS       180
     SGIAVGMATS IPPHNLQETV RAAIYLVRNR QSSLEQIMKI LPGPDFPTGS IIVGKEAFKE       240
     IYATGKGSFK IRAKISIDYA GIGHTNLVIT ELPYMVGSER VIEKIKQGVN AHRIDGILDV       300
     TDLSDRKNGL KLVIGIKPNF SPNEVMDNLY RHTPLEESFS VNSVALIDGK PKTLGMLDML       360
     KVFIDHRVCV ITRRSKFYLA THKKRLHMID GLLLALVDID KTISIIRNSE GIKEARKNLM       420
     KCLNVTRDQA EYILDIRLNM LTKLSTIKLQ SEQEELRKTT QDLEEILSDP NKIDAILIDE       480
     LKKVAQRLPS PRRTILESSV KSKKQKTDYP RQVVLTTNGF IFTIEVNNDL ISELSQPETF       540
     DMTFNTHSEP LRVVKSSIVC GVRSRIGALT SAGKVIPFTP IGLPVLDSGF VTAKSFLGLE       600
     NDEEAVLLFE LHQKESLAIA TSSGIVKRVT PAIWPDRTER VITLSAGDRV VGAARGVSSC       660
     GYFVFITAKG NLLHYSAGLV NPQNRPARGV AGVTLKDDDD RVISFGYTED VDRANVLTVS       720
     KRMTTSRLSS YQTRGRATRG VQCHKFLKGE EWLHAAIVGE NLAAIDNLGN VVAIGKSSVT       780
     AKSCAGVKQY RLPQEKSGKS KREDRLIRYL GYPFVHGNDT Y                           821
//

If you have problems or comments...

PBIL Back to PBIL home page