(data stored in ACNUC30630 zone)

EMBL: BX251410.PE256

BX251410.PE256       Location/Qualifiers
FT   CDS             complement(310102..311025)
FT                   /transl_table=11
FT                   /locus_tag="TW274"
FT                   /product="conserved DNA-binding protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO5855 or SC9B10.22c SWALL:O50529 (EMBL:AL009204)
FT                   (352 aa) fasta scores: E(): 0.00048, 28.57% id in 350 aa"
FT                   /protein_id="CAD66948.1"
FT                   /translation="MYDLSVIGLEDGFLILAAEDGTKFRIAANELLPYADPATQPPVRD
FT                   VLDGCGAASVKDIQALIREGLPAEKVAQKLSTSIERVKRFEPPVAAERSHMAQMALGVS
FT                   FGDKSFGEILLSALEKKGVSEYKISAKKGFSAWVLGVEYVSDAEPHHATWDFNHKDMSL
FT                   RPVDATARELVPEEICSETFDSFPKEMNFGALGSLSFDSENRTRAAENTPGFFSVNDVA
FT                   VAREKEPLLDDSARDLVDALRKRHKESIEQQRVAKTDINQVANLIDIDRKRDARAADPE
FT                   RARQTSRRTSVPSWDEILFGSDKNKN"
     MYDLSVIGLE DGFLILAAED GTKFRIAANE LLPYADPATQ PPVRDVLDGC GAASVKDIQA        60
     LIREGLPAEK VAQKLSTSIE RVKRFEPPVA AERSHMAQMA LGVSFGDKSF GEILLSALEK       120
     KGVSEYKISA KKGFSAWVLG VEYVSDAEPH HATWDFNHKD MSLRPVDATA RELVPEEICS       180
     ETFDSFPKEM NFGALGSLSF DSENRTRAAE NTPGFFSVND VAVAREKEPL LDDSARDLVD       240
     ALRKRHKESI EQQRVAKTDI NQVANLIDID RKRDARAADP ERARQTSRRT SVPSWDEILF       300
     GSDKNKN                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page