(data stored in ACNUC30630 zone)

EMBL: BX251410.PE257

BX251410.PE257       Location/Qualifiers
FT   CDS             311166..311444
FT                   /transl_table=11
FT                   /locus_tag="TW275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO5864 or SC2E9.05 SWALL:O54130 (EMBL:AL021530)
FT                   (98 aa) fasta scores: E(): 8.6e-13, 49.48% id in 97 aa"
FT                   /protein_id="CAD66949.1"
FT                   /translation="MHTDYDTPRQTEELTESIEVLEKTATDDLNTDVDEDFDSASFELP
FT                   GADLSDTDLEVVVIPPQENEFTCTSCFLVKHRLQLSSVANMCKDCAG"
     MHTDYDTPRQ TEELTESIEV LEKTATDDLN TDVDEDFDSA SFELPGADLS DTDLEVVVIP        60
     PQENEFTCTS CFLVKHRLQL SSVANMCKDC AG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page