(data stored in ACNUC30630 zone)

EMBL: BX251410.PE258

BX251410.PE258       Location/Qualifiers
FT   CDS             complement(311511..311978)
FT                   /transl_table=11
FT                   /locus_tag="TW276"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Mycobacterium leprae u1764i ml1027
FT                   putative membrane protein SWALL:Q49991 (EMBL:U15181) (157
FT                   aa) fasta scores: E(): 2.4e-10, 33.76% id in 154 aa"
FT                   /protein_id="CAD66950.1"
FT                   /translation="MIMRYTERLWPGPGLFLAVALAMPISGLISMPVLQRAGVTLLWSI
FT                   PIAAGVYILLCLWLRVMSPKLEVSGGIFRAGHVEIPIKYIGTCRVINRKDVHDELGLRL
FT                   HPRSFKMTRGWVKDLVKISIIDPEDPTPYWIVSSRKPQKLVDAIKACPSDS"
     MIMRYTERLW PGPGLFLAVA LAMPISGLIS MPVLQRAGVT LLWSIPIAAG VYILLCLWLR        60
     VMSPKLEVSG GIFRAGHVEI PIKYIGTCRV INRKDVHDEL GLRLHPRSFK MTRGWVKDLV       120
     KISIIDPEDP TPYWIVSSRK PQKLVDAIKA CPSDS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page