(data stored in ACNUC30630 zone)

EMBL: BX251410.PE260

BX251410.PE260       Location/Qualifiers
FT   CDS             312484..313059
FT                   /transl_table=11
FT                   /locus_tag="TW278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak and partial similarity to Streptomyces
FT                   coelicolor hypothetical protein SCO5869 or SC2E9.10
FT                   SWALL:O54135 (EMBL:AL021530) (250 aa) fasta scores: E():
FT                   2.5e-19, 40% id in 175 aa"
FT                   /protein_id="CAD66952.1"
FT                   /translation="MDDRSKTGPFDESEVDSVRIFVDLGGIKVPPCERLSIRLEFDRVT
FT                   NKPVALGLDYGKSTLQVQPFAAPSNSSLWEDVRKQLRDQLLSRGAHLVETDGALGKELR
FT                   ASIPVLMAGETFSETRWARIVGVDGPRWLLRGVIVGEALTNDSAAAEIENLFRSLVVVR
FT                   GNLPMPPHEMIPLRMPLELTSGVTQSLV"
     MDDRSKTGPF DESEVDSVRI FVDLGGIKVP PCERLSIRLE FDRVTNKPVA LGLDYGKSTL        60
     QVQPFAAPSN SSLWEDVRKQ LRDQLLSRGA HLVETDGALG KELRASIPVL MAGETFSETR       120
     WARIVGVDGP RWLLRGVIVG EALTNDSAAA EIENLFRSLV VVRGNLPMPP HEMIPLRMPL       180
     ELTSGVTQSL V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page