(data stored in ACNUC30630 zone)

EMBL: BX251410.PE264

BX251410.PE264       Location/Qualifiers
FT   CDS             317665..318867
FT                   /transl_table=11
FT                   /locus_tag="TW282"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66956.1"
FT                   /translation="MNRRQGLRFVRSACFRLLCALSLGIVMYGAFAVLSFLTSIAIGSF
FT                   TFPSFDSSSPPGSQFFSSGPQSLFAVPMVGFLQGASLLATGFSRFAFDTAFGSMRFTVS
FT                   SLPVSTVVLLVILFISSRLLERFLPSKSLKEKILLSLSSSVVVTLLALFSLFVSDPTII
FT                   YGLFFLIFDFLALFLTDLLGRLRLRLTGFIRESLFFVTLFVVLGFVVLVVLIVPSYTEF
FT                   PFLLSALVIYSVPLSVVFAAYAGGAGFFLRVDSVYEKVSYFHTHMLFVLVLLILLFFVA
FT                   LRLAAMRKPCTKKQALSSIWHMPTAVFLLAIVLSCFTAGFSISPVVPSGSFVTVEVGMN
FT                   GVIFAVLLMAWAYLVQVFAIYAAPFVARRIPFLYRIIRLGVRKRGTVSRKQIKRVLKGL
FT                   P"
     MNRRQGLRFV RSACFRLLCA LSLGIVMYGA FAVLSFLTSI AIGSFTFPSF DSSSPPGSQF        60
     FSSGPQSLFA VPMVGFLQGA SLLATGFSRF AFDTAFGSMR FTVSSLPVST VVLLVILFIS       120
     SRLLERFLPS KSLKEKILLS LSSSVVVTLL ALFSLFVSDP TIIYGLFFLI FDFLALFLTD       180
     LLGRLRLRLT GFIRESLFFV TLFVVLGFVV LVVLIVPSYT EFPFLLSALV IYSVPLSVVF       240
     AAYAGGAGFF LRVDSVYEKV SYFHTHMLFV LVLLILLFFV ALRLAAMRKP CTKKQALSSI       300
     WHMPTAVFLL AIVLSCFTAG FSISPVVPSG SFVTVEVGMN GVIFAVLLMA WAYLVQVFAI       360
     YAAPFVARRI PFLYRIIRLG VRKRGTVSRK QIKRVLKGLP                             400
//

If you have problems or comments...

PBIL Back to PBIL home page