(data stored in ACNUC30630 zone)

EMBL: BX251410.PE268

BX251410.PE268       Location/Qualifiers
FT   CDS             complement(321314..323884)
FT                   /transl_table=11
FT                   /locus_tag="TW286"
FT                   /product="class I tRNA synthetase (I, L, M and V)"
FT                   /note="Similar to Rickettsia conorii valyl-tRNA synthetase
FT                   ValS or rc1053 SWALL:Q92GR9 (EMBL:AE008656) (812 aa) fasta
FT                   scores: E(): 3.5e-56, 39.75% id in 825 aa, and to
FT                   Thermotoga maritima isoleucyl-tRNA synthetase IleS or
FT                   tm1361 SWALL:SYI_THEMA (SWALL:P46213) (919 aa) fasta
FT                   scores: E(): 2.7e-24, 24.4% id in 881 aa"
FT                   /db_xref="GOA:Q83I17"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I17"
FT                   /protein_id="CAD66960.1"
FT                   /translation="MNIPDKPSLEGLEEKWSKLWKSSKIYNFELEQVSAKQDVYSIDTP
FT                   PPTASGVLHIGHVFSYTHTDIIARFQRMQGKIVFYPMGWDDNGLPTERRVQNYFSVRCD
FT                   PSLPYCQNLKLAQINNDSMARSISRRNFIELCQQLSEEDERKFEELWNYLGLSVDWSQT
FT                   YRTIDDDAIHLSQHFFLENVNSGAAYQDWAPTLWDVTYRTAVAQAEIEERQITGFYYRL
FT                   AFENENATVEIETTRPELLAGCVALVAHPDDNRYKHLFGSHVITPVFDVKVPVLPHRAA
FT                   QPDKGSGIAMVCTFGDITDVQWWRDLNLQSCPIIDASGRVVPDAPDPIVSERGRRAFAT
FT                   LSGKTLSAAKKHTLEMLISEKSIIGEPRKITHPVKFFEKGDKPLEILLTRQWYIRNGYS
FT                   DNALTERLIELGKQLQWYPKTMLRRYEDWLTGLNSDWLISRQRFLGVPFPIWYQTDDRG
FT                   NAKFDDPIFPDRKDLPLDPTIAVPRGYSENQRGAPNGFVAETDVMDTWATSSLTPQLAG
FT                   KYLKNPKLFEAIFPYSLRPQGQDIIRTWLFSSIIRSEYAHATAPWKSTAISGFILDPDR
FT                   KKMSKSKGNAKTPKDILDRYGADAVRYWAACARLGVDTALDVENPTQIKIGRRLALKVL
FT                   NAARFVVHLHKNKETYSGQPDMKRCYPIDFAAISNPLDLSLLKQLDQTIEQSTNALKNF
FT                   DHSKALDTTETFFWNFCDNYVEIVKDRAYAGDESALTTLLVVTNIVIKLLAPFIPYATE
FT                   EAWSWFNETSVHTQSWPETLKLHSGDIELLKIACSFMSLVRGGKTEAKLSQKTEIAYLK
FT                   IALPNPEIIMPIMDDLRRAGKIDKCELIDGDAQILAIEYGEISR"
     MNIPDKPSLE GLEEKWSKLW KSSKIYNFEL EQVSAKQDVY SIDTPPPTAS GVLHIGHVFS        60
     YTHTDIIARF QRMQGKIVFY PMGWDDNGLP TERRVQNYFS VRCDPSLPYC QNLKLAQINN       120
     DSMARSISRR NFIELCQQLS EEDERKFEEL WNYLGLSVDW SQTYRTIDDD AIHLSQHFFL       180
     ENVNSGAAYQ DWAPTLWDVT YRTAVAQAEI EERQITGFYY RLAFENENAT VEIETTRPEL       240
     LAGCVALVAH PDDNRYKHLF GSHVITPVFD VKVPVLPHRA AQPDKGSGIA MVCTFGDITD       300
     VQWWRDLNLQ SCPIIDASGR VVPDAPDPIV SERGRRAFAT LSGKTLSAAK KHTLEMLISE       360
     KSIIGEPRKI THPVKFFEKG DKPLEILLTR QWYIRNGYSD NALTERLIEL GKQLQWYPKT       420
     MLRRYEDWLT GLNSDWLISR QRFLGVPFPI WYQTDDRGNA KFDDPIFPDR KDLPLDPTIA       480
     VPRGYSENQR GAPNGFVAET DVMDTWATSS LTPQLAGKYL KNPKLFEAIF PYSLRPQGQD       540
     IIRTWLFSSI IRSEYAHATA PWKSTAISGF ILDPDRKKMS KSKGNAKTPK DILDRYGADA       600
     VRYWAACARL GVDTALDVEN PTQIKIGRRL ALKVLNAARF VVHLHKNKET YSGQPDMKRC       660
     YPIDFAAISN PLDLSLLKQL DQTIEQSTNA LKNFDHSKAL DTTETFFWNF CDNYVEIVKD       720
     RAYAGDESAL TTLLVVTNIV IKLLAPFIPY ATEEAWSWFN ETSVHTQSWP ETLKLHSGDI       780
     ELLKIACSFM SLVRGGKTEA KLSQKTEIAY LKIALPNPEI IMPIMDDLRR AGKIDKCELI       840
     DGDAQILAIE YGEISR                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page