(data stored in ACNUC30630 zone)

EMBL: BX251410.PE27

BX251410.PE27        Location/Qualifiers
FT   CDS             complement(26537..26869)
FT                   /transl_table=11
FT                   /locus_tag="TW027"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO4845 or SC5G8.13 SWALL:Q9KZA1
FT                   (EMBL:AL353872) (157 aa) fasta scores: E(): 2.9e-08, 41.3%
FT                   id in 92 aa"
FT                   /protein_id="CAD66719.1"
FT                   /translation="MLLGFRNIAYGSVLAASVAVIVSISFNWIGNRHLVFRGLRRDGVL
FT                   REAVRFFLVSIGGSLVQLACLVVSHYGMGFTSILADNIASNLVGLPLATVLRFIGYYFW
FT                   VFSKRK"
     MLLGFRNIAY GSVLAASVAV IVSISFNWIG NRHLVFRGLR RDGVLREAVR FFLVSIGGSL        60
     VQLACLVVSH YGMGFTSILA DNIASNLVGL PLATVLRFIG YYFWVFSKRK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page