(data stored in ACNUC30630 zone)

EMBL: BX251410.PE31

BX251410.PE31        Location/Qualifiers
FT   CDS             complement(29804..30667)
FT                   /transl_table=11
FT                   /locus_tag="TW032"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="Similar to Streptomyces rishiriensis
FT                   dTDP-4-keto-6-deoxyhexose reductase CouS SWALL:Q9F8T1
FT                   (EMBL:AF235050) (288 aa) fasta scores: E(): 4.4e-46, 48.52%
FT                   id in 272 aa, and to Saccharopolyspora spinosa
FT                   dTDP-4-dehydrorhamnose reductase Kre SWALL:Q93EJ9
FT                   (EMBL:AF355468) (305 aa) fasta scores: E(): 4.2e-36, 43.34%
FT                   id in 293 aa"
FT                   /protein_id="CAD66723.1"
FT                   /translation="MSLKCLITGGGGMLGRDIRSVFPESVALTHDELDITDEYAVLDAA
FT                   RNKDLLINCAAYTQVDAAESNAAKAYAVNEAGARAVAKAAARRSIRVVHISTDYVFSGT
FT                   AIRPYPEDHPHSPLSVYGKSKAAGEKAVLEEYSKGSFIIRTAWLYGQYGNNFVKSILKA
FT                   CRTQDIVTVVNDQYGQPTWSLDLAKQIKLLAESDAPCGVYHGTNSGKTTWFDFAGKVAA
FT                   LGGYDPKRIIPISSAQFVRPARRPGYSCLGHDAWTAVGLEPMRPWEDALNDAWAAGVFA
FT                   ECIAGQ"
     MSLKCLITGG GGMLGRDIRS VFPESVALTH DELDITDEYA VLDAARNKDL LINCAAYTQV        60
     DAAESNAAKA YAVNEAGARA VAKAAARRSI RVVHISTDYV FSGTAIRPYP EDHPHSPLSV       120
     YGKSKAAGEK AVLEEYSKGS FIIRTAWLYG QYGNNFVKSI LKACRTQDIV TVVNDQYGQP       180
     TWSLDLAKQI KLLAESDAPC GVYHGTNSGK TTWFDFAGKV AALGGYDPKR IIPISSAQFV       240
     RPARRPGYSC LGHDAWTAVG LEPMRPWEDA LNDAWAAGVF AECIAGQ                     287
//

If you have problems or comments...

PBIL Back to PBIL home page