(data stored in ACNUC30630 zone)

EMBL: BX251410.PE32

BX251410.PE32        Location/Qualifiers
FT   CDS             complement(30664..31647)
FT                   /transl_table=11
FT                   /locus_tag="TW033"
FT                   /product="putative dehydratase"
FT                   /note="Similar to Streptomyces tenebrarius AprE
FT                   SWALL:Q9F5R6 (EMBL:AF306787) (332 aa) fasta scores: E():
FT                   8.2e-88, 64.83% id in 327 aa"
FT                   /protein_id="CAD66724.1"
FT                   /translation="MTHILVTGGAGFIGSNFVRRAIENKYPEIRDCTVTVLDALTYSGN
FT                   INNLSPVRSSSRLRFIHGDIRDEDLLSEIMPNVNYVVHFAAETHVDRSIKNASAFVETN
FT                   VLGTGRLLEAAARNNIDRFIHISTDEVYGSIESGSWDENQPLLPNSPYSASKAASDLLV
FT                   RSYHKTYDLPVCITRCSNNYGPYQFPEKVIPLFVTNLIEDKEVPLYGDGTNVRDWLHVD
FT                   DHCRGIYIVLTKGRSGEIYNIGGGLELSNADLSQIILEVMEKSWSMVKRVKDRPGHDKR
FT                   YSVSINKISTLGYRPEVSFEQGLAETINWYKDNSSWWKPLKARAAL"
     MTHILVTGGA GFIGSNFVRR AIENKYPEIR DCTVTVLDAL TYSGNINNLS PVRSSSRLRF        60
     IHGDIRDEDL LSEIMPNVNY VVHFAAETHV DRSIKNASAF VETNVLGTGR LLEAAARNNI       120
     DRFIHISTDE VYGSIESGSW DENQPLLPNS PYSASKAASD LLVRSYHKTY DLPVCITRCS       180
     NNYGPYQFPE KVIPLFVTNL IEDKEVPLYG DGTNVRDWLH VDDHCRGIYI VLTKGRSGEI       240
     YNIGGGLELS NADLSQIILE VMEKSWSMVK RVKDRPGHDK RYSVSINKIS TLGYRPEVSF       300
     EQGLAETINW YKDNSSWWKP LKARAAL                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page