(data stored in ACNUC30630 zone)

EMBL: BX251410.PE33

BX251410.PE33        Location/Qualifiers
FT   CDS             31892..32515
FT                   /transl_table=11
FT                   /locus_tag="TW035"
FT                   /product="putative epimerase"
FT                   /note="Similar to Streptomyces antibioticus
FT                   dTDP-4-keto-6-deoxyglucose 3,5-epimerase SWALL:Q9L6C5
FT                   (EMBL:AF237894) (202 aa) fasta scores: E(): 4e-34, 50% id
FT                   in 192 aa"
FT                   /protein_id="CAD66725.1"
FT                   /translation="MELRNLKVNGCLEVTPEVHVDSRGSFSEVYRFDVLEKEIGYPLRV
FT                   AQVNRSFSKKAVLRGLHYSLAPHSQAKYVMCANGAVLDFVFDLRLGSPSFGVWDAVLLD
FT                   SVGCRAVYIPEGVGHAFIALSKTATVNYLCSATYDPEREKSINPLDKNLNLEYPFTTPE
FT                   IVLSERDAAAPTLPEAQKGGFLPKWDECRWDECRATPETHGNIR"
     MELRNLKVNG CLEVTPEVHV DSRGSFSEVY RFDVLEKEIG YPLRVAQVNR SFSKKAVLRG        60
     LHYSLAPHSQ AKYVMCANGA VLDFVFDLRL GSPSFGVWDA VLLDSVGCRA VYIPEGVGHA       120
     FIALSKTATV NYLCSATYDP EREKSINPLD KNLNLEYPFT TPEIVLSERD AAAPTLPEAQ       180
     KGGFLPKWDE CRWDECRATP ETHGNIR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page