(data stored in ACNUC30630 zone)

EMBL: BX251410.PE34

BX251410.PE34        Location/Qualifiers
FT   CDS             32571..33449
FT                   /transl_table=11
FT                   /locus_tag="TW036"
FT                   /product="putative nucleotidyl transferase"
FT                   /note="Similar to Streptomyces sphaeroides NovV
FT                   SWALL:Q9L9E6 (EMBL:AF170880) (297 aa) fasta scores: E():
FT                   6.5e-76, 66.78% id in 286 aa, and to Escherichia coli
FT                   glucose-1-phosphate thymidylyltransferase RffH or b3789
FT                   SWALL:RFFH_ECOLI (SWALL:P27831) (293 aa) fasta scores: E():
FT                   6.6e-69, 59.17% id in 289 aa"
FT                   /protein_id="CAD66726.1"
FT                   /translation="MKGIILAGGTGSRLWPITKCISKQLMPVYDKPMIYYPLSTLMMAD
FT                   IREILVITTTQDYDQFRRLLGDGGQWGIKLSYAQQLSPGGLAQAFLIGESFIASESIAL
FT                   VLGDNIFHGSGLGTSLRQHRSIQGALIFAYHVSNPKDYGVVTFDADGKAVSIEEKPESP
FT                   KSNFAVPGLYFYDNQVVDIAKQIPLSARGELEISSVNNFYLEKDQLRVYPLARGTSWLD
FT                   TGTFDSLVQASEYVRVIEQRQGFKVGCVEEIAWRAGWIDDDQLAKLANGLMKSGYGKYL
FT                   HYLLSGKHGFS"
     MKGIILAGGT GSRLWPITKC ISKQLMPVYD KPMIYYPLST LMMADIREIL VITTTQDYDQ        60
     FRRLLGDGGQ WGIKLSYAQQ LSPGGLAQAF LIGESFIASE SIALVLGDNI FHGSGLGTSL       120
     RQHRSIQGAL IFAYHVSNPK DYGVVTFDAD GKAVSIEEKP ESPKSNFAVP GLYFYDNQVV       180
     DIAKQIPLSA RGELEISSVN NFYLEKDQLR VYPLARGTSW LDTGTFDSLV QASEYVRVIE       240
     QRQGFKVGCV EEIAWRAGWI DDDQLAKLAN GLMKSGYGKY LHYLLSGKHG FS               292
//

If you have problems or comments...

PBIL Back to PBIL home page