(data stored in ACNUC30630 zone)

EMBL: BX251410.PE36

BX251410.PE36        Location/Qualifiers
FT   CDS             complement(34302..35108)
FT                   /transl_table=11
FT                   /locus_tag="TW038"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="Similar to Myxococcus xanthus O-antigen export
FT                   system ATP-binding protein RfbB SWALL:RFBB_MYXXA
FT                   (SWALL:Q50863) (437 aa) fasta scores: E(): 2.3e-30, 48.92%
FT                   id in 233 aa"
FT                   /protein_id="CAD66728.1"
FT                   /translation="MKNKMSVVNSNAVKLAKSKHYTGVTNDNAILRVSNVSKKFVIQHN
FT                   RSIKERLLNFRVSRANREPFWALKNITFELPIGSSVGLVGHNGSGKSTLLKLIGGIVRA
FT                   TEGEILSRGRISALIELGAGFHPDLTGRENIYLNGSILGLTKAEIRRNFDSIVDFSGIE
FT                   KFIDTQVKFYSSGMYMRLAFSVSVHTDPDLLLIDEILAVGDAPFQKKCLNKVTQFKNEG
FT                   RSIVMVSHVAEQIETVCDKVMVLKNGRLIYYGTTKVGLDLLRENYQ"
     MKNKMSVVNS NAVKLAKSKH YTGVTNDNAI LRVSNVSKKF VIQHNRSIKE RLLNFRVSRA        60
     NREPFWALKN ITFELPIGSS VGLVGHNGSG KSTLLKLIGG IVRATEGEIL SRGRISALIE       120
     LGAGFHPDLT GRENIYLNGS ILGLTKAEIR RNFDSIVDFS GIEKFIDTQV KFYSSGMYMR       180
     LAFSVSVHTD PDLLLIDEIL AVGDAPFQKK CLNKVTQFKN EGRSIVMVSH VAEQIETVCD       240
     KVMVLKNGRL IYYGTTKVGL DLLRENYQ                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page