(data stored in ACNUC30630 zone)

EMBL: BX251410.PE37

BX251410.PE37        Location/Qualifiers
FT   CDS             complement(35160..36041)
FT                   /transl_table=11
FT                   /locus_tag="TW039"
FT                   /product="putative ABC transport integral membrane subunit"
FT                   /note="Similar to Pseudomonas aeruginosa membrane-spanning
FT                   domain Msd Wzm SWALL:P72162 (EMBL:U63722) (265 aa) fasta
FT                   scores: E(): 8.6e-21, 30.68% id in 277 aa, and to
FT                   Myxococcus xanthus O-antigen export system permease protein
FT                   RfbA SWALL:RFBA_MYXXA (SWALL:Q50862) (260 aa) fasta scores:
FT                   E(): 1.2e-15, 26.83% id in 272 aa"
FT                   /protein_id="CAD66729.1"
FT                   /translation="MPENLIRARLLSKPLKPVGETGMSSLKGMWQRRALLSLLIQREIK
FT                   IRYKGTAFGVLWSMARPIVQLLVYYFAIGKILGAERGIDQFAIFIFVGFATWSLFAEIA
FT                   STAVVCMTNNGGLIKKIYLPRELFVVTALGNALFTFSIYILILMVAAPVLGQMPIDPTK
FT                   WQGFVGIGIAIVYATALGLVLAPLNVYMRDAQHFLDVALSILFWLTPIVYSFQRVNGAV
FT                   HSNIAEQLYLLNPMAIAVMGMQKTFWTAGSSVHWPADIDARLIIVFLVGLLLLFLAHRI
FT                   FVKMQANLAQEL"
     MPENLIRARL LSKPLKPVGE TGMSSLKGMW QRRALLSLLI QREIKIRYKG TAFGVLWSMA        60
     RPIVQLLVYY FAIGKILGAE RGIDQFAIFI FVGFATWSLF AEIASTAVVC MTNNGGLIKK       120
     IYLPRELFVV TALGNALFTF SIYILILMVA APVLGQMPID PTKWQGFVGI GIAIVYATAL       180
     GLVLAPLNVY MRDAQHFLDV ALSILFWLTP IVYSFQRVNG AVHSNIAEQL YLLNPMAIAV       240
     MGMQKTFWTA GSSVHWPADI DARLIIVFLV GLLLLFLAHR IFVKMQANLA QEL              293
//

If you have problems or comments...

PBIL Back to PBIL home page