(data stored in ACNUC30630 zone)

EMBL: BX251410.PE38

BX251410.PE38        Location/Qualifiers
FT   CDS             36116..37087
FT                   /transl_table=11
FT                   /locus_tag="TW040"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Actinobacillus actinomycetemcomitans DNA
FT                   for glycosyltransferase, lytic transglycosylase,
FT                   dTDP-4-rhamnose reductase SWALL:O05379 (EMBL:AB002668) (289
FT                   aa) fasta scores: E(): 3.2e-17, 30.73% id in 257 aa"
FT                   /protein_id="CAD66730.1"
FT                   /translation="MGVSVVMATYNGGPFLAEQLMSILSQTVLPDEIVIADDGSTDDTE
FT                   RIIFRFRGKFPNLLYIPSEGTRLGPGKNFERAIKRSSQEFIVFSDQDDIWQPDRIEIQQ
FT                   SALKSNPGAVLLHSNARLVDQDGNMLGDLFSALGITKTILTRINNGEAFNILLRRNVVT
FT                   GATVMTRREFALSTLPFPDAWLHDEWLAICGGNRVRVLDHCLIQYRQHDKNHIGARRLS
FT                   VREKFLKLFEDTDVRNARLLARTEALTNFAEEKSGNIFFNTREIGLIRKKLTHERFRST
FT                   LGKSRLLRIWPVLKRVSRYRQFSNFSADILRDLLSSRQHDKP"
     MGVSVVMATY NGGPFLAEQL MSILSQTVLP DEIVIADDGS TDDTERIIFR FRGKFPNLLY        60
     IPSEGTRLGP GKNFERAIKR SSQEFIVFSD QDDIWQPDRI EIQQSALKSN PGAVLLHSNA       120
     RLVDQDGNML GDLFSALGIT KTILTRINNG EAFNILLRRN VVTGATVMTR REFALSTLPF       180
     PDAWLHDEWL AICGGNRVRV LDHCLIQYRQ HDKNHIGARR LSVREKFLKL FEDTDVRNAR       240
     LLARTEALTN FAEEKSGNIF FNTREIGLIR KKLTHERFRS TLGKSRLLRI WPVLKRVSRY       300
     RQFSNFSADI LRDLLSSRQH DKP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page