(data stored in ACNUC30630 zone)

EMBL: BX251410.PE39

BX251410.PE39        Location/Qualifiers
FT   CDS             complement(37195..37551)
FT                   /transl_table=11
FT                   /locus_tag="TW041"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66731.1"
FT                   /translation="MTSYFFGILVSIALLVILIEMLRREKLRERHAVWWLLAGFIAVFF
FT                   AVFPGILRWISNLLGIITPINLVLFMAVILLFLVCLQQSCELAKLDKRTRRLAEDTLLL
FT                   QDELEDIKSHSSKE"
     MTSYFFGILV SIALLVILIE MLRREKLRER HAVWWLLAGF IAVFFAVFPG ILRWISNLLG        60
     IITPINLVLF MAVILLFLVC LQQSCELAKL DKRTRRLAED TLLLQDELED IKSHSSKE         118
//

If you have problems or comments...

PBIL Back to PBIL home page