(data stored in ACNUC30630 zone)

EMBL: BX251410.PE4

BX251410.PE4         Location/Qualifiers
FT   CDS             4011..4445
FT                   /transl_table=11
FT                   /locus_tag="TW004"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3875 or SCH18.12c SWALL:Y2H5_STRCO
FT                   (SWALL:P35925) (190 aa) fasta scores: E(): 5.9, 24.32% id
FT                   in 111 aa"
FT                   /protein_id="CAD66696.1"
FT                   /translation="MNQYLKISNTAGYCRPIQDFSSNPFDPGRDPVWVSNLVGDFIKKF
FT                   DCNNCLKGNNISNIWPEVVGDFGARNTEVVEITRKGELVISCLSRAIALSFRVYSEDII
FT                   KKLNDRYPDLNLEKLIFVPPESRRGYFGPKLVRNVDKHYE"
     MNQYLKISNT AGYCRPIQDF SSNPFDPGRD PVWVSNLVGD FIKKFDCNNC LKGNNISNIW        60
     PEVVGDFGAR NTEVVEITRK GELVISCLSR AIALSFRVYS EDIIKKLNDR YPDLNLEKLI       120
     FVPPESRRGY FGPKLVRNVD KHYE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page