(data stored in ACNUC30630 zone)

EMBL: BX251410.PE40

BX251410.PE40        Location/Qualifiers
FT   CDS             complement(37548..38276)
FT                   /transl_table=11
FT                   /locus_tag="TW042"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Actinobacillus actinomycetemcomitans
FT                   putative glycosyltransferase SWALL:Q9AQB2 (EMBL:AF213680)
FT                   (234 aa) fasta scores: E(): 6.3e-16, 28.99% id in 238 aa"
FT                   /protein_id="CAD66732.1"
FT                   /translation="MTNRVLVVVPAHNEALSLPGTLQEIKENLPGFSVLVIDDGSTDAT
FT                   SDAAEAHSIKVIRIPFNAGVGGAMRLGFRFALRKGFNVVVQVDADGQHNPKYVSELINR
FT                   LNNRHDKPDIVIGARFAGCGNYKLRGPRRWAIFALSKLMSRFAKTNLTDVTSGFRASGT
FT                   RAIKLFAEKYPTEYLGDTVESVAIALKEGLVVRQVPVAMRERKAGTPSHGPCRATLLLL
FT                   RVVVAALVAPLKSGKSKGCR"
     MTNRVLVVVP AHNEALSLPG TLQEIKENLP GFSVLVIDDG STDATSDAAE AHSIKVIRIP        60
     FNAGVGGAMR LGFRFALRKG FNVVVQVDAD GQHNPKYVSE LINRLNNRHD KPDIVIGARF       120
     AGCGNYKLRG PRRWAIFALS KLMSRFAKTN LTDVTSGFRA SGTRAIKLFA EKYPTEYLGD       180
     TVESVAIALK EGLVVRQVPV AMRERKAGTP SHGPCRATLL LLRVVVAALV APLKSGKSKG       240
     CR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page