(data stored in ACNUC30630 zone)

EMBL: BX251410.PE41

BX251410.PE41        Location/Qualifiers
FT   CDS             38634..40475
FT                   /transl_table=11
FT                   /locus_tag="TW043"
FT                   /product="putative large integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66733.1"
FT                   /translation="MRMSDSDTNSIPLTRSALRKIEKSSAAGASGLRRLRLAVLVPLLL
FT                   FISLAGWALSSPIGSSPDDDFHLASAWCALGDRPGLCESSGIKDAKKVPTTILDTWHGK
FT                   GSRHGNLYCFLNGVSPECQNKWLGNTDHKMQDTGRVNFGNNAQYTNLYYSAMGLLASDD
FT                   VRASVWGMRLINAFIFTALSLLLYLALPQPRRAALLITWSLSLVPAAMFFIPSSNPSSW
FT                   AFIGVPSTFFAMLSFFETRGRRKICLGIIAVFSVLLSAFARSDAAIYALLAIVISGILQ
FT                   VRDFKNPWAQFALPVALGIMSIATFFMYPLNVAATGLPATGARDYGFITFVKNIIFIPS
FT                   SFLPSVFTPQFLGWLDVPLYPPAYVFVAIAALIVVGFALGVGGVRKLFAVLLTLAALII
FT                   APLYVSQVAGITADKLLQPRYLAPLAIIFIAVVLYTGFGEVLQIKKRYMAVIFFLIAPA
FT                   NAFGIFSLLRHYDALPSFLGGALPPTSDGPNAGASRDALAGHHPPGSISAPDGAGTSGE
FT                   HSGSWWWPGFPVSPILLFSVVVASFTLALLIALRDVLKIRNEVNIANETEKALARARRL
FT                   SVSDTPALVNVGTGMITLSKISNATASITLEDAEDQS"
     MRMSDSDTNS IPLTRSALRK IEKSSAAGAS GLRRLRLAVL VPLLLFISLA GWALSSPIGS        60
     SPDDDFHLAS AWCALGDRPG LCESSGIKDA KKVPTTILDT WHGKGSRHGN LYCFLNGVSP       120
     ECQNKWLGNT DHKMQDTGRV NFGNNAQYTN LYYSAMGLLA SDDVRASVWG MRLINAFIFT       180
     ALSLLLYLAL PQPRRAALLI TWSLSLVPAA MFFIPSSNPS SWAFIGVPST FFAMLSFFET       240
     RGRRKICLGI IAVFSVLLSA FARSDAAIYA LLAIVISGIL QVRDFKNPWA QFALPVALGI       300
     MSIATFFMYP LNVAATGLPA TGARDYGFIT FVKNIIFIPS SFLPSVFTPQ FLGWLDVPLY       360
     PPAYVFVAIA ALIVVGFALG VGGVRKLFAV LLTLAALIIA PLYVSQVAGI TADKLLQPRY       420
     LAPLAIIFIA VVLYTGFGEV LQIKKRYMAV IFFLIAPANA FGIFSLLRHY DALPSFLGGA       480
     LPPTSDGPNA GASRDALAGH HPPGSISAPD GAGTSGEHSG SWWWPGFPVS PILLFSVVVA       540
     SFTLALLIAL RDVLKIRNEV NIANETEKAL ARARRLSVSD TPALVNVGTG MITLSKISNA       600
     TASITLEDAE DQS                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page